X-ray structure of iGluR4 flip ligand-binding core (S1S2) in complex with (S)-glutamate at 1.40A resolution. Determined by X-ray diffraction at 1.4 Å resolution. Released 9 Dec 2008.
Explore 3FAS in 3D Show helices and sheets RCSB PDB PDBe
3FAS contains 32 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-8 | 6 | 1 |
| β-strand | 11 | 1 | 2 |
| β-strand | 15 | 1 | 2 |
| β-strand | 16-17 | 2 | 3 |
| α-helix | 18 | 1 | |
| α-helix | 21-23 | 3 | |
| α-helix | 26-29 | 4 | |
| β-strand | 30-31 | 2 | 3 |
| α-helix | 33-45 | 13 | |
| β-strand | 48-53 | 6 | 1 |
| β-strand | 62 | 1 | 4 |
| β-strand | 69 | 1 | 4 |
| α-helix | 71-77 | 7 | |
| β-strand | 83-84 | 2 | 1 |
| β-strand | 89 | 1 | 5 |
| α-helix | 92-95 | 4 | |
| β-strand | 98-100 | 3 | 1 |
| α-helix | 101 | 1 | |
| α-helix | 103 | 1 | |
| β-strand | 105-107 | 3 | 5 |
| β-strand | 109-114 | 6 | 6 |
| α-helix | 122-126 | 5 | |
| β-strand | 132-134 | 3 | 6 |
| β-strand | 136 | 1 | 7 |
| α-helix | 140-147 | 8 | |
| α-helix | 151-161 | 11 | |
| β-strand | 169 | 1 | 7 |
| α-helix | 172-181 | 10 | |
| β-strand | 186-191 | 6 | 6 |
| α-helix | 192-199 | 8 | |
| β-strand | 206-209 | 4 | 6 |
| β-strand | 216-218 | 3 | 5 |
| β-strand | 221-223 | 3 | 1 |
| α-helix | 229-241 | 13 | |
| α-helix | 244-249 | 6 | |
| α-helix | 250-254 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-8 | 6 | 8 |
| β-strand | 11 | 1 | 9 |
| β-strand | 15 | 1 | 9 |
| β-strand | 16-17 | 2 | 10 |
| α-helix | 18 | 1 | |
| α-helix | 21-23 | 3 | |
| α-helix | 26-29 | 4 | |
| β-strand | 30-31 | 2 | 10 |
| α-helix | 33-45 | 13 | |
| β-strand | 48-53 | 6 | 8 |
| β-strand | 62 | 1 | 11 |
| β-strand | 69 | 1 | 11 |
| α-helix | 71-77 | 7 | |
| β-strand | 83-84 | 2 | 8 |
| β-strand | 89 | 1 | 12 |
| α-helix | 92-95 | 4 | |
| β-strand | 98-100 | 3 | 8 |
| α-helix | 101 | 1 | |
| α-helix | 103 | 1 | |
| β-strand | 105-107 | 3 | 12 |
| β-strand | 109-114 | 6 | 13 |
| α-helix | 122-126 | 5 | |
| β-strand | 132-134 | 3 | 13 |
| β-strand | 135-136 | 2 | 14 |
| α-helix | 140-147 | 8 | |
| α-helix | 151-161 | 11 | |
| β-strand | 168-169 | 2 | 14 |
| α-helix | 172-181 | 10 | |
| β-strand | 186-191 | 6 | 13 |
| α-helix | 192-198 | 7 | |
| β-strand | 206-209 | 4 | 13 |
| β-strand | 216-218 | 3 | 12 |
| β-strand | 221-223 | 3 | 8 |
| α-helix | 229-241 | 13 | |
| α-helix | 244-249 | 6 | |
| α-helix | 250-254 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glutamate receptor 4 | A, B | protein | 260 | Rattus norvegicus | P19493 (AlphaFold model) |
>3FAS_1 Glutamate receptor 4 (chains A, B) GRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYG ARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIE SAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVR KSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLS EAGVLDKLKNKWWYDKGECG
| ID | Name | Formula | Copies |
|---|---|---|---|
| GLU | Glutamic acid | C5 H9 N O4 | 2 |
Water and common crystallization additives (SO4, GOL) are not listed.
Molecular mechanism of agonist recognition by the ligand-binding core of the ionotropic glutamate receptor 4. Kasper, C., Frydenvang, K., Naur, P. et al. FEBS Lett (2008) 582:4089-4094. DOI 10.1016/j.febslet.2008.11.005 · PubMed
Other PDB entries of the same protein (UniProt P19493 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3FAS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.