9RN7: GluA4
GluA4 in complex with TARP-2, Desensitized state, structure of TMD domain. Determined by electron microscopy at 3.1 Å resolution. Released 24 Sept 2025.
- Method
- Electron microscopy
- Resolution
- 3.1 Å
- Organism
- Rattus norvegicus
- Chains
- 8
- Atoms
- 10,372
- Mol. weight
- 540.98 kDa
- Ligands
- PLM, CA, OLC
- Released
- 24 Sept 2025
Explore 9RN7 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9RN7 contains 51 α-helices and 31 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 533-535 | 3 | |
| β-strand | 543 | 1 | 1 |
| α-helix | 545-567 | 23 | |
| α-helix | 595-606 | 12 | |
| α-helix | 618-648 | 31 | |
| α-helix | 649-651 | 3 | |
| β-strand | 809 | 1 | 2 |
| α-helix | 816-831 | 16 | |
| α-helix | 833-845 | 13 | |
Chain B: 6 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 533-535 | 3 | |
| α-helix | 536-540 | 5 | |
| β-strand | 543 | 1 | 3 |
| α-helix | 545-567 | 23 | |
| α-helix | 597-606 | 10 | |
| α-helix | 620-648 | 29 | |
| β-strand | 809 | 1 | 1 |
| α-helix | 815-843 | 29 | |
Chain C: 9 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 538-540 | 3 | |
| β-strand | 543 | 1 | 4 |
| α-helix | 545-547 | 3 | |
| α-helix | 551-567 | 17 | |
| α-helix | 595-605 | 11 | |
| α-helix | 618-626 | 9 | |
| α-helix | 632-647 | 16 | |
| α-helix | 806-808 | 3 | |
| β-strand | 809 | 1 | 3 |
| α-helix | 816-819 | 4 | |
| α-helix | 821-844 | 24 | |
Chain D: 8 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 543 | 1 | 2 |
| α-helix | 545-549 | 5 | |
| α-helix | 552-567 | 16 | |
| α-helix | 595-606 | 12 | |
| α-helix | 618-647 | 30 | |
| α-helix | 808 | 1 | |
| β-strand | 809 | 1 | 4 |
| α-helix | 810 | 1 | |
| α-helix | 811-814 | 4 | |
| α-helix | 817-845 | 29 | |
Chain E: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-29 | 22 | |
| β-strand | 34-38 | 5 | 5 |
| β-strand | 57-61 | 5 | 5 |
| β-strand | 65-67 | 3 | 6 |
| β-strand | 68 | 1 | 5 |
| β-strand | 77-79 | 3 | 6 |
| α-helix | 94-104 | 11 | |
| α-helix | 106-126 | 21 | |
| α-helix | 133-162 | 30 | |
| β-strand | 174-176 | 3 | 5 |
| α-helix | 178-211 | 34 | |
Chain F: 6 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-29 | 22 | |
| β-strand | 34 | 1 | 7 |
| β-strand | 35-38 | 4 | 8 |
| β-strand | 57-60 | 4 | 8 |
| β-strand | 65-68 | 4 | 8 |
| β-strand | 77-79 | 3 | 8 |
| α-helix | 93-104 | 12 | |
| α-helix | 106-127 | 22 | |
| α-helix | 133-152 | 20 | |
| α-helix | 155-158 | 4 | |
| β-strand | 176 | 1 | 7 |
| α-helix | 178-211 | 34 | |
Chain G: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-29 | 21 | |
| β-strand | 34-38 | 5 | 9 |
| β-strand | 57-61 | 5 | 9 |
| β-strand | 65-68 | 4 | 9 |
| β-strand | 77-79 | 3 | 9 |
| α-helix | 94-104 | 11 | |
| α-helix | 106-127 | 22 | |
| α-helix | 133-160 | 28 | |
| β-strand | 175-176 | 2 | 9 |
| α-helix | 178-211 | 34 | |
Chain H: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-29 | 22 | |
| β-strand | 34-38 | 5 | 10 |
| β-strand | 57-61 | 5 | 10 |
| β-strand | 65 | 1 | 11 |
| β-strand | 66-68 | 3 | 10 |
| β-strand | 79 | 1 | 11 |
| α-helix | 96-99 | 4 | |
| α-helix | 106-128 | 23 | |
| α-helix | 133-162 | 30 | |
| β-strand | 175-176 | 2 | 10 |
| α-helix | 178-211 | 34 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Isoform 2 of Glutamate receptor 4 | A, B, C, D | protein | 882 | Rattus norvegicus | P19493 (AlphaFold model) |
| Voltage-dependent calcium channel gamma-2 subunit | E, F, G, H | protein | 323 | Rattus norvegicus | Q71RJ2 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>9RN7_1 Isoform 2 of Glutamate receptor 4 (chains A, B, C, D)
GAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVT
NAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRG
ALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEE
LDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVT
GFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKI
DISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK
STGPRKVGYWNDMDKLVLIQDMPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGN
DKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAP
LTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSV
VLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSG
RIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEF
FRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPC
DTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDS
GSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEATRNKAR
LSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASDLP
Sequence of entity 2 (E, F, G, H), FASTA
>9RN7_2 Voltage-dependent calcium channel gamma-2 subunit (chains E, F, G, H)
MGLFDRGVQMLLTIVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH
SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL
CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF
YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS
SRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH
NCIQKDSKDSLHANTANRRTTPV
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| PLM | Palmitic acid | C16 H32 O2 | 4 |
| CA | Calcium ion | Ca | 1 |
| OLC | (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate | C21 H40 O4 | 4 |
Primary citation
GluA4 AMPA receptor gating mechanisms and modulation by auxiliary proteins. Vega-Gutierrez, C., Picanol-Parraga, J., Sanchez-Valls, I. et al. Nat Struct Mol Biol (2025) 32:2416-2428. DOI 10.1038/s41594-025-01666-7 · PubMed
Other PDB entries of the same protein (UniProt P19493 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3FAS 1.4 Å, X-ray structure of iGluR4 flip ligand-binding core (S1S2) in complex with (S)-glutamate…
- 3EPE 1.85 Å, Crystal Structure of the GluR4 Ligand-Binding domain in complex with glutamate
- 3FAT 1.9 Å, X-ray structure of iGluR4 flip ligand-binding core (S1S2) in complex with (S)-AMPA at…
- 3KEI 1.9 Å, Crystal Structure of the GluA4 Ligand-Binding domain L651V mutant in complex with…
- 3KFM 2.2 Å, Crystal Structure of the GluA4 Ligand-Binding domain L651V mutant in complex with kainate
- 4GPA 2.25 Å, High resolution structure of the GluA4 N-terminal domain (NTD)
- 3EN3 2.43 Å, Crystal Structure of the GluR4 Ligand-Binding domain in complex with kainate
- 5FWX 2.5 Å, Crystal structure of the AMPA receptor GluA2/A4 N-terminal domain heterodimer
- 9QDN 2.71 Å, GluA4 in complex with TARP-2, resting state I, structure of TMD/LBD
- 9RMW 2.9 Å, GluA4 in complex with TARP-2, open state, structure of TMD/LBD domains
- 9NR6 3.26 Å, The structure of Noelin 1 with cerebellar GluA1/A4-ATD
- 9P9B 3.31 Å, Activated GluA4 homotetrameric AMPAR.
Browse structure collections
About this viewer
MolViewer shows 9RN7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.