9P9B: Activated GluA4 homotetrameric AMPAR
Activated GluA4 homotetrameric AMPAR. Determined by electron microscopy at 3.31 Å resolution. Released 28 Jan 2026.
- Method
- Electron microscopy
- Resolution
- 3.31 Å
- Organisms
- Rattus norvegicus, Mus musculus
- Chains
- 8
- Atoms
- 18,100
- Mol. weight
- 474.97 kDa
- Ligands
- CYZ, GLU
- Released
- 28 Jan 2026
Explore 9P9B in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9P9B contains 113 α-helices and 101 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 21 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 417-421 | 5 | 1 |
| β-strand | 429-430 | 2 | 2 |
| β-strand | 443-444 | 2 | 2 |
| α-helix | 446-458 | 13 | |
| β-strand | 462-466 | 5 | 1 |
| α-helix | 467 | 1 | |
| β-strand | 475 | 1 | 3 |
| β-strand | 482 | 1 | 3 |
| α-helix | 484-490 | 7 | |
| β-strand | 496 | 1 | 1 |
| β-strand | 497 | 1 | 4 |
| β-strand | 502 | 1 | 5 |
| α-helix | 507-509 | 3 | |
| β-strand | 511-513 | 3 | 4 |
| α-helix | 514 | 1 | |
| α-helix | 516 | 1 | |
| β-strand | 518-520 | 3 | 5 |
| β-strand | 522-527 | 6 | 6 |
| α-helix | 528-530 | 3 | |
| α-helix | 538-540 | 3 | |
| β-strand | 543 | 1 | 7 |
| α-helix | 545-567 | 23 | |
| α-helix | 596-606 | 11 | |
| α-helix | 618-642 | 25 | |
| α-helix | 658-661 | 4 | |
| β-strand | 668-671 | 4 | 6 |
| β-strand | 672 | 1 | 8 |
| α-helix | 676-683 | 8 | |
| α-helix | 687-698 | 12 | |
| β-strand | 705 | 1 | 8 |
| α-helix | 708-718 | 11 | |
| β-strand | 722-727 | 6 | 6 |
| α-helix | 728-736 | 9 | |
| β-strand | 742-745 | 4 | 6 |
| β-strand | 752-754 | 3 | 5 |
| β-strand | 757-759 | 3 | 4 |
| α-helix | 765-777 | 13 | |
| α-helix | 780-786 | 7 | |
| α-helix | 787-791 | 5 | |
| α-helix | 811-813 | 3 | |
| α-helix | 815-839 | 25 | |
Chain B: 27 helices, 24 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 417-421 | 5 | 9 |
| β-strand | 424 | 1 | 10 |
| β-strand | 428 | 1 | 10 |
| β-strand | 429-430 | 2 | 11 |
| α-helix | 434-436 | 3 | |
| α-helix | 439-442 | 4 | |
| β-strand | 443-444 | 2 | 11 |
| α-helix | 446-458 | 13 | |
| β-strand | 462-466 | 5 | 9 |
| β-strand | 475 | 1 | 12 |
| α-helix | 481 | 1 | |
| β-strand | 482 | 1 | 12 |
| α-helix | 483 | 1 | |
| α-helix | 484-490 | 7 | |
| β-strand | 496-497 | 2 | 9 |
| β-strand | 502 | 1 | 13 |
| α-helix | 505-508 | 4 | |
| β-strand | 511-513 | 3 | 9 |
| α-helix | 514 | 1 | |
| α-helix | 516 | 1 | |
| β-strand | 518-520 | 3 | 13 |
| β-strand | 522-527 | 6 | 14 |
| α-helix | 528-531 | 4 | |
| β-strand | 532 | 1 | 15 |
| α-helix | 533-535 | 3 | |
| α-helix | 536-540 | 5 | |
| β-strand | 543 | 1 | 16 |
| α-helix | 545-567 | 23 | |
| α-helix | 596-606 | 11 | |
| α-helix | 618-645 | 28 | |
| β-strand | 650 | 1 | 15 |
| α-helix | 658-663 | 6 | |
| β-strand | 668-670 | 3 | 14 |
| β-strand | 671-672 | 2 | 17 |
| α-helix | 676-683 | 8 | |
| α-helix | 687-698 | 12 | |
| β-strand | 704-705 | 2 | 17 |
| α-helix | 708-717 | 10 | |
| β-strand | 722-727 | 6 | 14 |
| α-helix | 728-734 | 7 | |
| β-strand | 742-745 | 4 | 14 |
| β-strand | 752-754 | 3 | 13 |
| β-strand | 757-759 | 3 | 9 |
| α-helix | 765-777 | 13 | |
| α-helix | 780-788 | 9 | |
| α-helix | 790-792 | 3 | |
| α-helix | 808 | 1 | |
| β-strand | 809 | 1 | 7 |
| α-helix | 810 | 1 | |
| α-helix | 811-813 | 3 | |
| α-helix | 815-838 | 24 | |
Chain C: 23 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 417-421 | 5 | 18 |
| β-strand | 424 | 1 | 19 |
| β-strand | 428 | 1 | 19 |
| α-helix | 434-436 | 3 | |
| α-helix | 439-442 | 4 | |
| α-helix | 446-458 | 13 | |
| β-strand | 462-466 | 5 | 18 |
| β-strand | 475 | 1 | 20 |
| α-helix | 481 | 1 | |
| β-strand | 482 | 1 | 20 |
| α-helix | 483 | 1 | |
| α-helix | 484-490 | 7 | |
| β-strand | 496-497 | 2 | 18 |
| β-strand | 502 | 1 | 18 |
| α-helix | 505-508 | 4 | |
| β-strand | 511-520 | 10 | 18 |
| β-strand | 522-527 | 6 | 21 |
| α-helix | 528-531 | 4 | |
| α-helix | 538-540 | 3 | |
| α-helix | 545-565 | 21 | |
| α-helix | 596-606 | 11 | |
| α-helix | 618-642 | 25 | |
| α-helix | 649-651 | 3 | |
| α-helix | 659-662 | 4 | |
| β-strand | 668-670 | 3 | 21 |
| β-strand | 671-672 | 2 | 22 |
| α-helix | 676-681 | 6 | |
| α-helix | 687-696 | 10 | |
| β-strand | 704-705 | 2 | 22 |
| α-helix | 708-717 | 10 | |
| β-strand | 722-727 | 6 | 21 |
| α-helix | 728-735 | 8 | |
| β-strand | 742-745 | 4 | 21 |
| β-strand | 752-759 | 8 | 18 |
| α-helix | 765-777 | 13 | |
| α-helix | 780-788 | 9 | |
| α-helix | 804-806 | 3 | |
| β-strand | 809 | 1 | 16 |
| α-helix | 811-813 | 3 | |
| α-helix | 815-838 | 24 | |
Chain D: 21 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 417-421 | 5 | 23 |
| β-strand | 429-430 | 2 | 24 |
| α-helix | 434-436 | 3 | |
| α-helix | 440-442 | 3 | |
| β-strand | 443-444 | 2 | 24 |
| α-helix | 446-458 | 13 | |
| β-strand | 462-466 | 5 | 23 |
| β-strand | 475 | 1 | 25 |
| β-strand | 482 | 1 | 25 |
| α-helix | 484-490 | 7 | |
| β-strand | 496-497 | 2 | 23 |
| β-strand | 502 | 1 | 23 |
| α-helix | 505-508 | 4 | |
| β-strand | 511-520 | 10 | 23 |
| β-strand | 522 | 1 | 26 |
| β-strand | 524-527 | 4 | 27 |
| α-helix | 528-531 | 4 | |
| β-strand | 532 | 1 | 28 |
| α-helix | 533-535 | 3 | |
| α-helix | 536-540 | 5 | |
| α-helix | 545-567 | 23 | |
| α-helix | 596-606 | 11 | |
| α-helix | 618-639 | 22 | |
| β-strand | 650 | 1 | 28 |
| α-helix | 658-662 | 5 | |
| β-strand | 668-670 | 3 | 27 |
| β-strand | 672 | 1 | 29 |
| α-helix | 676-683 | 8 | |
| α-helix | 687-698 | 12 | |
| β-strand | 705 | 1 | 29 |
| α-helix | 708-717 | 10 | |
| β-strand | 722-724 | 3 | 27 |
| β-strand | 727 | 1 | 26 |
| α-helix | 728-734 | 7 | |
| β-strand | 742-745 | 4 | 27 |
| β-strand | 752-759 | 8 | 23 |
| α-helix | 765-777 | 13 | |
| α-helix | 780-788 | 9 | |
| α-helix | 797-802 | 6 | |
| α-helix | 811-813 | 3 | |
| α-helix | 815-839 | 25 | |
Chain E: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-28 | 20 | |
| β-strand | 34-38 | 5 | 33 |
| β-strand | 57-61 | 5 | 33 |
| β-strand | 65-68 | 4 | 33 |
| β-strand | 78-79 | 2 | 33 |
| α-helix | 95-104 | 10 | |
| α-helix | 106-122 | 17 | |
| α-helix | 133-158 | 26 | |
| β-strand | 175-176 | 2 | 33 |
| α-helix | 178-209 | 32 | |
Chain F: 6 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-29 | 22 | |
| β-strand | 34-38 | 5 | 31 |
| β-strand | 57-61 | 5 | 31 |
| β-strand | 65-68 | 4 | 31 |
| β-strand | 77-79 | 3 | 31 |
| α-helix | 95-104 | 10 | |
| α-helix | 106-127 | 22 | |
| α-helix | 133-159 | 27 | |
| β-strand | 175-176 | 2 | 31 |
| α-helix | 178-206 | 29 | |
| α-helix | 207-209 | 3 | |
Chain G: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-29 | 21 | |
| β-strand | 34-37 | 4 | 32 |
| β-strand | 58-61 | 4 | 32 |
| β-strand | 65-68 | 4 | 32 |
| β-strand | 77-79 | 3 | 32 |
| α-helix | 96-104 | 9 | |
| α-helix | 106-124 | 19 | |
| α-helix | 133-159 | 27 | |
| β-strand | 175-176 | 2 | 32 |
| α-helix | 178-209 | 32 | |
Chain H: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-28 | 21 | |
| β-strand | 34-36 | 3 | 30 |
| β-strand | 58-61 | 4 | 30 |
| β-strand | 65-69 | 5 | 30 |
| β-strand | 77-79 | 3 | 30 |
| α-helix | 95-104 | 10 | |
| α-helix | 106-124 | 19 | |
| α-helix | 133-159 | 27 | |
| β-strand | 175-176 | 2 | 30 |
| α-helix | 178-209 | 32 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Isoform 2 of Glutamate receptor 4 | A, B, C, D | protein | 846 | Rattus norvegicus | P19493 (AlphaFold model) |
| Voltage-dependent calcium channel gamma-2 subunit | E, F, G, H | protein | 209 | Mus musculus | O88602 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>9P9B_1 Isoform 2 of Glutamate receptor 4 (chains A, B, C, D)
MGKIMHISVLLSPVLWGLIFGVSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPF
NLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSF
PTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVS
AICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANL
GFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTY
DGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQ
FDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDMPTLGNDTAAIENRTVVVTTI
MESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIW
NGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDP
LAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFS
LGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLA
KQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKF
AFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLD
KLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRA
EAKRMK
Sequence of entity 2 (E, F, G, H), FASTA
>9P9B_2 Voltage-dependent calcium channel gamma-2 subunit (chains E, F, G, H)
GLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSEDETSKKNEEVMTHS
GLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGLC
IAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSFY
FGALSFIIAEMVGVLAVHMFIDRHKQLTG
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CYZ | Cyclothiazide | C14 H16 Cl N3 O4 S2 | 4 |
| GLU | Glutamic acid | C5 H9 N O4 | 4 |
Primary citation
Structural basis for activation and conformational plasticity of the GluA4 AMPA receptor. Hale, W.D., Wang, H., Huganir, R.L. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-68953-9 · PubMed
Other PDB entries of the same protein (UniProt P19493 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3FAS 1.4 Å, X-ray structure of iGluR4 flip ligand-binding core (S1S2) in complex with (S)-glutamate…
- 3EPE 1.85 Å, Crystal Structure of the GluR4 Ligand-Binding domain in complex with glutamate
- 3FAT 1.9 Å, X-ray structure of iGluR4 flip ligand-binding core (S1S2) in complex with (S)-AMPA at…
- 3KEI 1.9 Å, Crystal Structure of the GluA4 Ligand-Binding domain L651V mutant in complex with…
- 3KFM 2.2 Å, Crystal Structure of the GluA4 Ligand-Binding domain L651V mutant in complex with kainate
- 4GPA 2.25 Å, High resolution structure of the GluA4 N-terminal domain (NTD)
- 3EN3 2.43 Å, Crystal Structure of the GluR4 Ligand-Binding domain in complex with kainate
- 5FWX 2.5 Å, Crystal structure of the AMPA receptor GluA2/A4 N-terminal domain heterodimer
- 9QDN 2.71 Å, GluA4 in complex with TARP-2, resting state I, structure of TMD/LBD
- 9RMW 2.9 Å, GluA4 in complex with TARP-2, open state, structure of TMD/LBD domains
- 9RN7 3.1 Å, GluA4 in complex with TARP-2, Desensitized state, structure of TMD domain
- 9NR6 3.26 Å, The structure of Noelin 1 with cerebellar GluA1/A4-ATD
Browse structure collections
About this viewer
MolViewer shows 9P9B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.