3FDO: Human MDMX

Name: PDB 3FDO: Structure of human MDMX in complex with high affinity peptide
Published: 2008-12-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cell cycle

Structure of human MDMX in complex with high affinity peptide. Determined by X-ray diffraction at 1.4 Å resolution. Released 16 Dec 2008.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 988
Mol. weight: 11.89 kDa
Ligands: MG
Released: 16 Dec 2008

Explore 3FDO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FDO contains 5 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	27-29	3	1
α-helix	31-38	8
β-strand	47	1	1
α-helix	49-63	15
β-strand	66-67	2	2
β-strand	70-75	6	2
α-helix	80-85	6
β-strand	89-91	3	2
α-helix	96-105	10
β-strand	106-108	3	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	19-24	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein Mdm4	A	protein	90	Homo sapiens	O15151 (AlphaFold model)
Synthetic high affinity peptide	B	protein	12

Sequence of entity 1 (A), FASTA

>3FDO_1 Protein Mdm4 (chains A)
IQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLL
GELLGRQSFSVKDPSPLYDMLRKNLVTLAT

Sequence of entity 2 (B), FASTA

>3FDO_2 Synthetic high affinity peptide (chains B)
LTFEHYWAQLTS

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	5

Primary citation

High affinity interaction of the p53 peptide-analogue with human Mdm2 and Mdmx. Czarna, A., Popowicz, G.M., Pecak, A. et al. Cell Cycle (2009) 8:1176-1184. DOI 10.4161/cc.8.8.8185 · PubMed

Other PDB entries of the same protein (UniProt O15151 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Q9Y 1.2 Å, HDMX (14-111; C17S) COMPLEXED WITH COMPOUND 16 AT 1.20A; Structural states of Hdm2 and…
3FEA 1.33 Å, Crystal Structure of HdmX bound to the p53-peptidomimetic…
3FE7 1.35 Å, Crystal Structure of HdmX bound to the p53-peptidomimetic…
3LBJ 1.5 Å, Structure of human MDMX protein in complex with a small molecule inhibitor
4RXZ 1.55 Å, Crystal Structure of MDMX phosporylated Tyr99 in complex with a 12-mer peptide
6Q9W 1.55 Å, X-ray structure of compound 15 bound to HdmX: Structural states of Hdm2 and HdmX: X-ray…
3EQY 1.63 Å, Crystal structure of human MDMX in complex with a 12-mer peptide inhibitor
7C3Y 1.63 Å, Crystal structure of the N-terminal domain of human MdmX protein in complex with Nutlin3a
7C44 1.65 Å, Crystal structure of the p53-binding domain of human MdmX protein in complex with Nutlin3a
8HDG 1.73 Å, Small peptide enhances the binding of nutline-3a to MdmX
3JZP 1.74 Å, Human MDMX liganded with a 12mer peptide inhibitor (pDI6W)
3JZO 1.8 Å, Human MDMX liganded with a 12mer peptide (pDI)

Browse structure collections

About this viewer

MolViewer shows 3FDO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.