Structure of NK cell receptor KLRG1 bound to E-cadherin. Determined by X-ray diffraction at 1.8 Å resolution. Released 28 Jul 2009.
Explore 3FF7 in 3D Show helices and sheets RCSB PDB PDBe
3FF7 contains 14 α-helices and 50 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| α-helix | 5-7 | 3 | |
| β-strand | 19-23 | 5 | 2 |
| β-strand | 25-26 | 2 | 1 |
| α-helix | 27-30 | 4 | |
| β-strand | 35-39 | 5 | 3 |
| β-strand | 41 | 1 | 4 |
| β-strand | 45 | 1 | 4 |
| β-strand | 51-53 | 3 | 2 |
| β-strand | 59-62 | 4 | 2 |
| α-helix | 66-68 | 3 | |
| β-strand | 71 | 1 | 5 |
| β-strand | 73-81 | 9 | 3 |
| β-strand | 87 | 1 | 3 |
| β-strand | 92-97 | 6 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 6 |
| β-strand | 19-23 | 5 | 7 |
| β-strand | 25-26 | 2 | 6 |
| α-helix | 27-30 | 4 | |
| β-strand | 35-40 | 6 | 8 |
| β-strand | 41 | 1 | 9 |
| β-strand | 45 | 1 | 9 |
| β-strand | 51-53 | 3 | 7 |
| β-strand | 59-62 | 4 | 7 |
| α-helix | 66-68 | 3 | |
| β-strand | 71 | 1 | 10 |
| β-strand | 73-81 | 9 | 8 |
| β-strand | 87 | 1 | 8 |
| β-strand | 92-97 | 6 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 80-82 | 3 | 11 |
| β-strand | 85-89 | 5 | 11 |
| β-strand | 94 | 1 | 12 |
| α-helix | 96-104 | 9 | |
| β-strand | 109-110 | 2 | 11 |
| α-helix | 116-123 | 8 | |
| β-strand | 131-137 | 7 | 10 |
| β-strand | 141-143 | 3 | 10 |
| α-helix | 147 | 1 | |
| β-strand | 148 | 1 | 10 |
| α-helix | 149 | 1 | |
| β-strand | 154-155 | 2 | 10 |
| β-strand | 163-167 | 5 | 10 |
| β-strand | 170-174 | 5 | 10 |
| β-strand | 180 | 1 | 12 |
| β-strand | 181-182 | 2 | 10 |
| β-strand | 183-185 | 3 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 79 | 1 | |
| β-strand | 80-82 | 3 | 13 |
| β-strand | 85-89 | 5 | 13 |
| β-strand | 94 | 1 | 14 |
| α-helix | 96-105 | 10 | |
| β-strand | 109-110 | 2 | 13 |
| α-helix | 116-123 | 8 | |
| β-strand | 131-137 | 7 | 5 |
| β-strand | 141-143 | 3 | 5 |
| α-helix | 147 | 1 | |
| β-strand | 148 | 1 | 5 |
| α-helix | 149 | 1 | |
| β-strand | 154-155 | 2 | 5 |
| β-strand | 163-167 | 5 | 5 |
| β-strand | 170-174 | 5 | 5 |
| β-strand | 180 | 1 | 14 |
| β-strand | 181-182 | 2 | 5 |
| β-strand | 183-185 | 3 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Epithelial cadherin | A, B | protein | 100 | Homo sapiens | P12830 (AlphaFold model) |
| Killer cell lectin-like receptor subfamily G member 1 | C, D | protein | 112 | Homo sapiens | Q96E93 (AlphaFold model) |
>3FF7_1 Epithelial cadherin (chains A, B) MDWVIPPISLPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGW LKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVT
>3FF7_2 Killer cell lectin-like receptor subfamily G member 1 (chains C, D) CPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFSWIG LRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKK
Structure of natural killer cell receptor KLRG1 bound to E-cadherin reveals basis for MHC-independent missing self recognition. Li, Y., Hofmann, M., Wang, Q. et al. Immunity (2009) 31:35-46. DOI 10.1016/j.immuni.2009.04.019 · PubMed
Other PDB entries of the same protein (UniProt P12830 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3FF7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.