3GZ1: IpgC

Name: PDB 3GZ1: Crystal structure of IpgC in complex with the chaperone binding region of IpaB
Published: 2009-06-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of IpgC in complex with the chaperone binding region of IpaB. Determined by X-ray diffraction at 2.15 Å resolution. Released 16 Jun 2009.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Shigella flexneri
Chains: 4
Atoms: 2,565
Mol. weight: 39.4 kDa
Released: 16 Jun 2009

Explore 3GZ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GZ1 contains 19 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	9-19	11
α-helix	33-48	16
α-helix	52-65	14
α-helix	70-82	13
α-helix	86-99	14
α-helix	105-116	12
α-helix	120-133	14
α-helix	137-150	14

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	15-21	7
α-helix	25-28	4
α-helix	33-48	16
α-helix	52-65	14
α-helix	70-82	13
α-helix	86-100	15
α-helix	105-116	12
α-helix	120-133	14
α-helix	137-149	13

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	67-70	4

Chain Q: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	67-69	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chaperone protein ipgC	A, B	protein	151	Shigella flexneri	P0A2U4 (AlphaFold model)
Invasin ipaB	P, Q	protein	22	Shigella flexneri	P18011 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3GZ1_1 Chaperone protein ipgC (chains A, B)
GSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFR
FLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAP
LKAKECFELVIQHSNDEKLKIKAQSYLDAIQ

Sequence of entity 2 (P, Q), FASTA

>3GZ1_2 Invasin ipaB (chains P, Q)
INTTNAHSTSNILIPELKAPKS

Primary citation

IpaB-IpgC interaction defines binding motif for type III secretion translocator. Lunelli, M., Lokareddy, R.K., Zychlinsky, A. et al. Proc Natl Acad Sci U S A (2009) 106:9661-9666. DOI 10.1073/pnas.0812900106 · PubMed

Other PDB entries of the same protein (UniProt P0A2U4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7P42 1.5 Å, Crystal structure of IpgC in complex with a follow-up compound based on J2
7PE0 1.5 Å, Crystal structure of IpgC in complex with J52
7PEF 1.54 Å, Crystal structure of IpgC in complex with DMSO
7NRG 1.57 Å, Crystal structure of a shortened IpgC variant in complex with…
6SCB 1.58 Å, Crystal structure of a shortened IpgC variant with two bound Magnesium and two bound…
7O6S 1.58 Å, Crystal structure of a shortened IpgC variant in complex with…
7B1U 1.59 Å, Crystal structure of a shortened IpgC variant in complex with…
7NL8 1.59 Å, Crystal structure of a shortened IpgC variant in complex with 3-methylbenzohydrazide
7OWV 1.59 Å, Crystal structure of IpgC in complex with a follow-up compound based on J20
7AXY 1.63 Å, Crystal structure of a shortened IpgC variant in complex with…
7AZV 1.68 Å, Crystal structure of a shortened IpgC variant in complex with…
7O04 1.74 Å, Crystal structure of a shortened IpgC variant in complex with…

Browse structure collections

About this viewer

MolViewer shows 3GZ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.