3GZ2: IpgC

Name: PDB 3GZ2: Crystal structure of IpgC in complex with an IpaB peptide
Published: 2010-04-21
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of IpgC in complex with an IpaB peptide. Determined by X-ray diffraction at 2.65 Å resolution. Released 21 Apr 2010.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Shigella flexneri
Chains: 3
Atoms: 2,398
Mol. weight: 42.98 kDa
Released: 21 Apr 2010

Explore 3GZ2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GZ2 contains 18 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	11-20	10
α-helix	25-28	4
α-helix	33-48	16
α-helix	52-65	14
α-helix	70-83	14
α-helix	86-99	14
α-helix	105-116	12
α-helix	120-133	14
α-helix	137-150	14

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	12-21	10
α-helix	25-28	4
α-helix	35-48	14
α-helix	52-65	14
α-helix	70-82	13
α-helix	86-98	13
α-helix	105-116	12
α-helix	120-133	14
α-helix	137-150	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chaperone protein ipgC	A, B	protein	151	Shigella flexneri	P0A2U4 (AlphaFold model)
Invasin ipaB	P	protein	78	Shigella flexneri	P18011 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3GZ2_1 Chaperone protein ipgC (chains A, B)
GSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFR
FLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAP
LKAKECFELVIQHSNDEKLKIKAQSYLDAIQ

Sequence of entity 2 (P), FASTA

>3GZ2_2 Invasin ipaB (chains P)
MGSSHHHHHHSSGLVPRGSHMILTSTELGDNTIQAANDAANKLFSLTIADLTANQNINTT
NAHSTSNILIPELKAPKS

Primary citation

Combination of two separate binding domains defines stoichiometry between type III secretion system chaperone IpgC and translocator protein IpaB. Lokareddy, R.K., Lunelli, M., Eilers, B. et al. J Biol Chem (2010) 285:39965-39975. DOI 10.1074/jbc.M110.135616 · PubMed

Other PDB entries of the same protein (UniProt P0A2U4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7P42 1.5 Å, Crystal structure of IpgC in complex with a follow-up compound based on J2
7PE0 1.5 Å, Crystal structure of IpgC in complex with J52
7PEF 1.54 Å, Crystal structure of IpgC in complex with DMSO
7NRG 1.57 Å, Crystal structure of a shortened IpgC variant in complex with…
6SCB 1.58 Å, Crystal structure of a shortened IpgC variant with two bound Magnesium and two bound…
7O6S 1.58 Å, Crystal structure of a shortened IpgC variant in complex with…
7B1U 1.59 Å, Crystal structure of a shortened IpgC variant in complex with…
7NL8 1.59 Å, Crystal structure of a shortened IpgC variant in complex with 3-methylbenzohydrazide
7OWV 1.59 Å, Crystal structure of IpgC in complex with a follow-up compound based on J20
7AXY 1.63 Å, Crystal structure of a shortened IpgC variant in complex with…
7AZV 1.68 Å, Crystal structure of a shortened IpgC variant in complex with…
7O04 1.74 Å, Crystal structure of a shortened IpgC variant in complex with…

Browse structure collections

About this viewer

MolViewer shows 3GZ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.