3HI9: ELAV-like protein 1

The x-ray crystal structure of the first RNA recognition motif (RRM1) of the AU-rich element (ARE) binding protein HuR at 2.0 angstrom resolution. Determined by X-ray diffraction at 2.0 Å resolution. Released 31 Mar 2010.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,701
Mol. weight: 37.01 kDa
Released: 31 Mar 2010

Explore 3HI9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HI9 contains 8 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C and D: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	21-25	5	1
α-helix	33-41	9
β-strand	46-53	8	1
β-strand	60-68	9	1
α-helix	71-81	11
β-strand	85-86	2	2
β-strand	89-90	2	2
β-strand	92-95	4	1

Chain B: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	21-25	5	3
α-helix	33-41	9
β-strand	46-51	6	3
β-strand	63-68	6	3
α-helix	71-81	11
β-strand	85-86	2	4
β-strand	89-90	2	4
β-strand	92-95	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ELAV-like protein 1	A, B, C, D	protein	84	Homo sapiens	Q15717 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3HI9_1 ELAV-like protein 1 (chains A, B, C, D)
GPGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAE
RAINTLNGLRLQSKTIKVSYARPS

Primary citation

The X-ray Crystal Structure of the First RNA Recognition Motif and Site-Directed Mutagenesis Suggest a Possible HuR Redox Sensing Mechanism. Benoit, R.M., Meisner, N.C., Kallen, J. et al. J Mol Biol (2010) 397:1231-1244. DOI 10.1016/j.jmb.2010.02.043 · PubMed

Other PDB entries of the same protein (UniProt Q15717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GD3 1.35 Å, Structure of HuR RRM3 in complex with RNA (UAUUUA)
4FXV 1.9 Å, Crystal structure of an ELAV-like protein 1 (ELAVL1) from Homo sapiens at 1.90 A…
6GC5 1.9 Å, Molecular basis for AU-rich element recognition and dimerization by the HuR C-terminal RRM
6GD2 1.9 Å, Structure of HuR RRM3 in complex with RNA
4ED5 2.0 Å, Crystal structure of the two N-terminal RRM domains of HuR complexed with RNA
6G2K 2.01 Å, Structure of HuR RRM3 in complex with RNA (UUUUUU)
6GD1 2.01 Å, Structure of HuR RRM3
4EGL 2.9 Å, Crystal structure of two tandem RNA recognition motifs of Human antigen R
9W2F 3.4 Å, Cryo-EM structure of DDB1-CRBN in complex with dHuR-2 and HuR
5SZW NMR solution structure of the RRM1 domain of the post-transcriptional regulator HuR

Browse structure collections

About this viewer

MolViewer shows 3HI9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.