3HO3: Hedgehog-interacting protein

Crystal structure of Hedgehog-interacting protein (HHIP). Determined by X-ray diffraction at 2.9 Å resolution. Released 23 Jun 2009.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,451
Mol. weight: 54.09 kDa
Released: 23 Jun 2009

Explore 3HO3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HO3 contains 6 α-helices and 39 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	218-223	6	1
β-strand	229-233	5	1
β-strand	237	1	2
β-strand	239	1	2
β-strand	242-246	5	1
β-strand	250-254	5	1
β-strand	260	1	1
β-strand	266-267	2	1
β-strand	284-289	6	3
α-helix	293-296	4
β-strand	298-305	8	3
β-strand	317-326	10	3
β-strand	334-347	14	3
β-strand	354-359	6	4
β-strand	365-369	5	4
β-strand	391-395	5	4
β-strand	396	1	5
β-strand	407	1	5
β-strand	424-427	4	4
β-strand	432	1	6
β-strand	434	1	7
β-strand	436-438	3	6
β-strand	446-454	9	6
β-strand	462-469	8	6
α-helix	477-479	3
β-strand	481-483	3	6
β-strand	491-496	6	7
β-strand	509-513	5	7
β-strand	518-520	3	7
β-strand	535	1	7
β-strand	550-556	7	1
β-strand	562-567	6	1
β-strand	577-583	7	1
α-helix	592-594	3
β-strand	617	1	8
β-strand	623	1	8
α-helix	624-626	3
β-strand	629-630	2	9
β-strand	636-637	2	9
α-helix	638	1
β-strand	648-649	2	10
β-strand	655-656	2	10
α-helix	657-658	2
β-strand	662	1	11
β-strand	668	1	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hedgehog-interacting protein	A	protein	481	Homo sapiens	Q96QV1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3HO3_1 Hedgehog-interacting protein (chains A)
SNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVK
ILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAI
GPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDG
MITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDP
GRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLV
GGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHIL
GFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLC
RNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEHHHHH
H

Primary citation

The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling. Bosanac, I., Maun, H.R., Scales, S.J. et al. Nat Struct Mol Biol (2009) 16:691-697. DOI 10.1038/nsmb.1632 · PubMed

Other PDB entries of the same protein (UniProt Q96QV1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PGN 2.4 Å, HHP-C in complex with glycosaminoglycan mimic SOS
2WG3 2.6 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…
7PGL 2.63 Å, HHIP-N, the N-terminal domain of the Hedgehog-Interacting Protein (HHIP), apo-form
7PGM 2.7 Å, HHIP-C in complex with heparin
7PGK 2.75 Å, HHIP-N, the N-terminal domain of the Hedgehog-Interacting Protein (HHIP), in complex…
2WFT 2.8 Å, Crystal structure of the human HIP ectodomain
3HO5 3.01 Å, Crystal structure of Hedgehog-interacting protein (HHIP) and Sonic hedgehog (SHH) complex
3HO4 3.1 Å, Crystal structure of Hedgehog-interacting protein (HHIP)
2WG4 3.15 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…
2WFX 3.2 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…

Browse structure collections

About this viewer

MolViewer shows 3HO3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.