3HO5: Hedgehog-interacting protein

Crystal structure of Hedgehog-interacting protein (HHIP) and Sonic hedgehog (SHH) complex. Determined by X-ray diffraction at 3.01 Å resolution. Released 23 Jun 2009.

Method: X-ray diffraction
Resolution: 3.01 Å
Organism: Homo sapiens
Chains: 3
Atoms: 8,255
Mol. weight: 127.51 kDa
Ligands: CA, ZN
Released: 23 Jun 2009

Explore 3HO5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HO5 contains 25 α-helices and 97 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 45 β-strands

Element	Residues	Length	Sheet
β-strand	217	1	1
β-strand	218-226	9	2
β-strand	229-233	5	2
β-strand	242-246	5	2
β-strand	250-254	5	2
α-helix	259	1
β-strand	260	1	2
α-helix	261	1
β-strand	266-267	2	2
β-strand	272	1	3
β-strand	284-289	6	3
α-helix	293-296	4
β-strand	298-305	8	3
β-strand	317-326	10	3
β-strand	334-347	14	3
β-strand	354-359	6	4
α-helix	361-363	3
β-strand	365-369	5	4
α-helix	376-381	6
β-strand	391-395	5	4
β-strand	396	1	5
β-strand	407	1	5
β-strand	424-427	4	4
β-strand	432	1	6
β-strand	434	1	7
α-helix	435	1
β-strand	436-438	3	6
β-strand	449-454	6	6
β-strand	462-467	6	6
α-helix	477-479	3
β-strand	481-483	3	6
β-strand	493-496	4	7
β-strand	509-512	4	7
β-strand	518-523	6	7
β-strand	530-532	3	7
β-strand	535	1	7
β-strand	537	1	1
β-strand	540	1	8
β-strand	543	1	8
β-strand	544	1	2
β-strand	550-556	7	2
β-strand	562-567	6	2
β-strand	577-583	7	2
β-strand	588	1	9
α-helix	592-594	3
α-helix	607-611	5
β-strand	617	1	10
β-strand	623	1	10
α-helix	624-626	3
β-strand	629-630	2	11
β-strand	636-637	2	11
α-helix	642-643	2
β-strand	648-651	4	12
β-strand	654-656	3	12
α-helix	657-658	2
β-strand	662	1	13
β-strand	668	1	13

Chain B: 8 helices, 44 β-strands

Element	Residues	Length	Sheet
β-strand	217	1	14
β-strand	218-226	9	15
β-strand	229-233	5	15
β-strand	242-246	5	15
β-strand	250-254	5	15
β-strand	260	1	15
β-strand	266-267	2	15
β-strand	272	1	16
β-strand	284-289	6	16
α-helix	293-296	4
β-strand	298-305	8	16
β-strand	317-326	10	16
β-strand	334-347	14	16
β-strand	354-359	6	17
β-strand	365-369	5	17
α-helix	376-380	5
β-strand	391-395	5	17
β-strand	396	1	18
β-strand	407	1	18
β-strand	424-427	4	17
β-strand	432	1	19
β-strand	434	1	20
β-strand	436-438	3	19
β-strand	449-454	6	19
β-strand	462-467	6	19
β-strand	481-483	3	19
β-strand	493-496	4	20
β-strand	509-512	4	20
β-strand	518-523	6	20
β-strand	530-535	6	20
β-strand	537	1	14
β-strand	540	1	21
β-strand	543	1	21
β-strand	544	1	15
β-strand	550-556	7	15
β-strand	562-567	6	15
α-helix	569-574	6
β-strand	577-583	7	15
β-strand	588	1	9
α-helix	592-594	3
α-helix	607-611	5
β-strand	615-617	3	22
β-strand	623-625	3	22
β-strand	629-630	2	23
β-strand	636-637	2	23
α-helix	638	1
α-helix	642-644	3
β-strand	648-651	4	24
β-strand	654-656	3	24
α-helix	657-658	2
β-strand	662	1	25
β-strand	668	1	25

Chain H: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	40-43	4
β-strand	47-48	2	26
β-strand	77-78	2	27
β-strand	84-86	3	26
α-helix	94-96	3
β-strand	97-98	2	27
α-helix	100-116	17
β-strand	122-126	5	26
β-strand	145-150	6	26
α-helix	155-157	3
α-helix	158-168	11
β-strand	172-174	3	26
β-strand	181-184	4	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hedgehog-interacting protein	A, B	protein	481	Homo sapiens	Q96QV1 (AlphaFold model)
Sonic hedgehog protein	H	protein	169	Homo sapiens	Q15465 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3HO5_1 Hedgehog-interacting protein (chains A, B)
SNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVK
ILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAI
GPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDG
MITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDP
GRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLV
GGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHIL
GFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLC
RNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEHHHHH
H

Sequence of entity 2 (H), FASTA

>3HO5_2 Sonic hedgehog protein (chains H)
GFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKD
EENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDI
TTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2
ZN	Zinc ion	Zn	2

Primary citation

The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling. Bosanac, I., Maun, H.R., Scales, S.J. et al. Nat Struct Mol Biol (2009) 16:691-697. DOI 10.1038/nsmb.1632 · PubMed

Other PDB entries of the same protein (UniProt Q96QV1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PGN 2.4 Å, HHP-C in complex with glycosaminoglycan mimic SOS
2WG3 2.6 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…
7PGL 2.63 Å, HHIP-N, the N-terminal domain of the Hedgehog-Interacting Protein (HHIP), apo-form
7PGM 2.7 Å, HHIP-C in complex with heparin
7PGK 2.75 Å, HHIP-N, the N-terminal domain of the Hedgehog-Interacting Protein (HHIP), in complex…
2WFT 2.8 Å, Crystal structure of the human HIP ectodomain
3HO3 2.9 Å, Crystal structure of Hedgehog-interacting protein (HHIP)
3HO4 3.1 Å, Crystal structure of Hedgehog-interacting protein (HHIP)
2WG4 3.15 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…
2WFX 3.2 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…

Browse structure collections

About this viewer

MolViewer shows 3HO5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.