3HXG: Schistsome eIF4E

Crystal structure of Schistsome eIF4E complexed with m7GpppA and 4E-BP. Determined by X-ray diffraction at 2.1 Å resolution. Released 25 Aug 2009.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Schistosoma mansoni, Homo sapiens
Chains: 2
Atoms: 1,783
Mol. weight: 25.46 kDa
Ligands: GTA
Released: 25 Aug 2009

Explore 3HXG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HXG contains 11 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	25-35	11	1
α-helix	43-46	4
β-strand	47-55	9	1
α-helix	56-65	10
α-helix	72-73	2
β-strand	77-82	6	1
α-helix	92-95	4
β-strand	98-103	6	1
α-helix	110-122	13
α-helix	129-134	6
β-strand	135-141	7	1
β-strand	148-153	6	1
α-helix	159-173	15
α-helix	178-179	2
β-strand	180-183	4	1
α-helix	184-189	6
α-helix	190-191	2
β-strand	201-202	2	1

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	10-17	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic Translation Initiation Factor 4E	A	protein	189	Schistosoma mansoni
Eukaryotic translation initiation factor 4E-binding protein 1	C	protein	21	Homo sapiens	Q13541 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3HXG_1 Eukaryotic Translation Initiation Factor 4E (chains A)
GPLGSPEFPHPLQDSWSYYLFQFRKALDWDECLEKVATFSTIEDFWSVLTHTVRPREITY
GKDLYMFKSDIMPKWEDPKNENGGRWLINVTARQDVDFLWDELLMLLIGSDWDTDEEDRQ
ICGAVFQPRSRGSKLSVWLTSDNEEETILSIGRRIKERLELEDTIYFQPVSDQRSQTRGS
DICTGKYEI

Sequence of entity 2 (C), FASTA

>3HXG_2 Eukaryotic translation initiation factor 4E-binding protein 1 (chains C)
SGSGRIIYDRKFLMECRNSPV

Ligands and cofactors

ID	Name	Formula	Copies
GTA	P1-7-methylguanosine-P3-adenosine-5',5'-triphosphate	C21 H30 N10 O17 P3	1

Primary citation

Structural insights into parasite EIF4E binding specificity for m7G and m2,2,7G mRNA cap. Liu, W., Zhao, R., McFarland, C. et al. J Biol Chem (2009) 284:31336-31349. DOI 10.1074/jbc.M109.049858 · PubMed

Other PDB entries of the same protein (UniProt Q13541 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2JGB 1.7 Å, Structure of human eIF4E homologous protein 4EHP with m7GTP
4UED 1.75 Å, Complex of human eIF4E with the 4E binding protein 4E-BP1
3HXI 1.8 Å, Crystal structure of Schistosome eIF4E complexed with m7GpppG and 4E-BP
5NVN 1.9 Å, Crystal structure of the human 4EHP-4E-BP1 complex
3M94 2.05 Å, Complex crystal structure of Ascaris suum eIF4E-3 with m2,2,7G cap
1WKW 2.1 Å, Crystal structure of the ternary complex of eIF4E-m7GpppA-4EBP1 peptide
2V8Y 2.1 Å, Crystallographic and mass spectrometric characterisation of eIF4E with N7-cap derivatives
3U7X 2.1 Å, Crystal structure of the human eIF4E-4EBP1 peptide complex without cap
5BXV 2.1 Å, eIF4E complex
1EJH 2.2 Å, EIF4E/EIF4G PEPTIDE/7-methyl-GDP
1EJ4 2.25 Å, Cocrystal structure of EIF4E/4E-BP1 peptide
2V8W 2.3 Å, Crystallographic and mass spectrometric characterisation of eIF4E with N7-cap derivatives

Browse structure collections

About this viewer

MolViewer shows 3HXG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.