3IDQ: S. cerevisiae Get3

Crystal structure of S. cerevisiae Get3 at 3.7 Angstrom resolution. Determined by X-ray diffraction at 3.7 Å resolution. Released 25 Aug 2009.

Method: X-ray diffraction
Resolution: 3.7 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 2,186
Mol. weight: 41.26 kDa
Ligands: NI, ZN
Released: 25 Aug 2009

Explore 3IDQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3IDQ contains 11 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	10-14	5
β-strand	20-24	5	1
α-helix	31-45	15
β-strand	51-55	5	1
α-helix	61-66	6
β-strand	83-87	5	1
α-helix	138-155	18
β-strand	163-166	4	1
α-helix	172-177	6
α-helix	179-188	10
α-helix	218-231	14
β-strand	236-243	8	1
α-helix	246-262	17
β-strand	265	1	1
β-strand	269-272	4	1
α-helix	286-305	20
β-strand	311-313	3	1
α-helix	324-335	12
α-helix	342-351	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATPase GET3	A	protein	369	Saccharomyces cerevisiae	Q12154 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3IDQ_1 ATPase GET3 (chains A)
MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAH
NLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSL
LQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLP
NTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVC
VCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLD
QIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKEGLVPRG
SLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	1
ZN	Zinc ion	Zn	1

Primary citation

Model for eukaryotic tail-anchored protein binding based on the structure of Get3. Suloway, C.J., Chartron, J.W., Zaslaver, M. et al. Proc Natl Acad Sci U S A (2009) 106:14849-14854. DOI 10.1073/pnas.0907522106 · PubMed

Other PDB entries of the same protein (UniProt Q12154 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WOJ 1.99 Å, ADP-AlF4 complex of S. cerevisiae GET3
4XTR 2.05 Å, Structure of Get3 bound to the transmembrane domain of Pep12
3ZS9 2.1 Å, S. cerevisiae Get3-ADP-AlF4- complex with a cytosolic Get2 fragment
3H84 2.3 Å, Crystal structure of GET3
4XVU 2.35 Å, Structure of Get3 bound to the transmembrane domain of Nyv1
4XWO 2.75 Å, Structure of Get3 bound to the transmembrane domain of Sec22
3A36 2.8 Å, Structural insight into the membrane insertion of tail-anchored proteins by Get3
5BW8 2.8 Å, 2.8 A crystal structure of a Get3-Get4-Get5 intermediate complex from S.cerevisiae
3A37 3.0 Å, Structural insight into the membrane insertion of tail-anchored proteins by Get3
3B2E 3.0 Å, Crystal structure of S. cerevisiae Get3 in the open conformation in complex with Get1…
3SJA 3.0 Å, Crystal structure of S. cerevisiae Get3 in the open state in complex with Get1 cytosolic…
3ZS8 3.0 Å, S. cerevisiae Get3 complexed with a cytosolic Get1 fragment

Browse structure collections

About this viewer

MolViewer shows 3IDQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.