3IDW: Sla1 homology domain 2

Name: PDB 3IDW: Crystal structure of Sla1 homology domain 2
Published: 2010-02-23
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: endocytosis

Crystal structure of Sla1 homology domain 2. Determined by X-ray diffraction at 1.85 Å resolution. Released 23 Feb 2010.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 576
Mol. weight: 8.59 kDa
Released: 23 Feb 2010

Explore 3IDW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3IDW contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	5-11	7
α-helix	16-28	13
α-helix	33-38	6
α-helix	41-46	6
α-helix	51-64	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin cytoskeleton-regulatory complex protein SLA1	A	protein	72	Saccharomyces cerevisiae	P32790 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3IDW_1 Actin cytoskeleton-regulatory complex protein SLA1 (chains A)
NKYDWFEFFLNCGVDVSNCQRYTINFDREQLTEDMMPDINNSMLRTLGLREGDIVRVMKH
LDKKFGRENIAS

Primary citation

Regulation of clathrin adaptor function in endocytosis: novel role for the SAM domain. Di Pietro, S.M., Cascio, D., Feliciano, D. et al. EMBO J (2010) 29:1033-1044. DOI 10.1038/emboj.2010.5 · PubMed

Other PDB entries of the same protein (UniProt P32790 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V1Q 1.2 Å, Atomic-resolution structure of the yeast Sla1 SH3 domain 3
1SSH 1.4 Å, Crystal structure of the SH3 domain from a S. cerevisiae hypothetical 40.4 kDa protein…
9HDB 1.49 Å, Sla1 SH3_3 domain (residues 355-414)
1Z9Z 1.95 Å, Crystal structure of yeast sla1 SH3 domain 3
2HBP Solution Structure of Sla1 Homology Domain 1
2JT4 Solution Structure of the Sla1 SH3-3-Ubiquitin Complex

Browse structure collections

About this viewer

MolViewer shows 3IDW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.