3IQM: Active site mutants of B. subtilis SecA

Active site mutants of B. subtilis SecA. Determined by X-ray diffraction at 3.4 Å resolution. Released 11 Aug 2010.

Method: X-ray diffraction
Resolution: 3.4 Å
Organism: Bacillus subtilis subsp. subtilis
Chains: 1
Atoms: 6,495
Mol. weight: 92.45 kDa
Released: 11 Aug 2010

Explore 3IQM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3IQM contains 46 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 46 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	10-28	19
α-helix	38-52	15
α-helix	58-61	4
α-helix	62-76	15
α-helix	83-94	12
β-strand	97-100	4	1
α-helix	106-109	4
α-helix	111-118	8
β-strand	124-128	5	1
α-helix	131-140	10
α-helix	142-147	6
β-strand	152-154	3	1
α-helix	163-169	7
β-strand	172-176	5	1
α-helix	177-186	10
α-helix	193-195	3
β-strand	203-207	5	1
α-helix	209	1
α-helix	210-214	5
α-helix	215-217	3
β-strand	221-224	4	2
α-helix	233-241	9
α-helix	264-267	4
α-helix	269-271	3
α-helix	280-298	19
α-helix	302-305	4
β-strand	306-307	2	3
β-strand	314-315	2	3
β-strand	316	1	4
β-strand	323	1	4
α-helix	330-332	3
α-helix	334-340	7
β-strand	351-355	5	2
α-helix	357-360	4
β-strand	366-371	6	1
α-helix	378-385	8
β-strand	389-392	4	1
α-helix	393-394	2
β-strand	401-402	2	5
α-helix	403-405	3
β-strand	406-408	3	6
α-helix	411-427	17
β-strand	432-435	4	5
α-helix	439-450	12
β-strand	457-458	2	5
α-helix	464-472	9
β-strand	481-483	3	5
α-helix	494-496	3
α-helix	499-502	4
β-strand	505-509	5	5
α-helix	516-523	8
α-helix	528-530	3
β-strand	533-537	5	5
β-strand	538-540	3	6
α-helix	544-549	6
α-helix	552-559	8
α-helix	563-565	3
β-strand	569	1	6
α-helix	572-618	47
α-helix	624-641	18
α-helix	654-662	9
α-helix	673-676	4
α-helix	681-702	22
α-helix	707-738	32
α-helix	748-777	30
α-helix	778-780	3
α-helix	786-788	3
β-strand	795-797	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein translocase subunit secA	A	protein	802	Bacillus subtilis subsp. subtilis	P28366 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3IQM_1 Protein translocase subunit secA (chains A)
MLGILNKMFDPTKRTLNRYEKIANDIDAIRGDYENLSDDALKHKTIEFKERLEKGATTDD
LLVEAFAVVREASRRVTGMFPFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVYLNALT
GKGVHVVTVNEYLASRDAEQMGKIFEFLGLTVGLNLNSMSKDEKREAYAADITYSTNNEL
GFDYLRDNMVLYKEQMVQRPLHFAVIDQVDSILIDEARTPLIISGQAAKSTKLYVQANAF
VRTLKAEKDYTYDIKTKAVQLTEEGMTKAEKAFGIDNLFDVKHVALNHHINQALKAHVAM
QKDVDYVVEDGQVVIVDSFTGRLMKGRRYSEGLHQAIEAKEGLEIQNESMTLATITFQNY
FRMYEKLAGMTGTAKTEEEEFRNIYNMQVVTIPTNRPVVRDDRPDLIYRTMEGKFKAVAE
DVAQRYMTGQPVLVGTVAVETSELISKLLKNKGIPHQVLNAKNHEREAQIIEEAGQKGAV
TIATNMAGRGTDIKLGEGVKELGGLAVVGTERHESRRIDNQLRGRSGRQGDPGITQFYLS
MEDELMRRFGAERTMAMLDRFGMDDSTPIQSKMVSRAVESSQKRVEGNNFDSRKQLLQYD
DVLRQQREVIYKQRFEVIDSENLREIVENMIKSSLERAIAAYTPREELPEEWKLDGLVDL
INTTYLDEGALEKSDIFGKEPDEMLELIMDRIITKYNEKEEQFGKEQMREFEKVIVLRAV
DSKWMDHIDAMDQLRQGIHLRAYAQTNPLREYQMEGFAMFEHMIESIEDEVAKFVMKAEI
ENNLEREEVVQGQTTAHQPQEG

Primary citation

ATPase Active-Site Electrostatic Interactions Control the Global Conformation of the 100 kDa SecA Translocase. Kim, D.M., Zheng, H., Huang, Y.J. et al. J Am Chem Soc (2013) 135:2999-3010. DOI 10.1021/ja306361q · PubMed

Other PDB entries of the same protein (UniProt P28366 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TF5 2.18 Å, Crystal structure of SecA in an open conformation from Bacillus Subtilis
3JV2 2.5 Å, Crystal Structure of B. subtilis SecA with bound peptide
1M6N 2.7 Å, Crystal structure of the SecA translocation ATPase from Bacillus subtilis
1TF2 2.9 Å, Crystal structure of SecA:ADP in an open conformation from Bacillus Subtilis
8YA0 2.97 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C)
1M74 3.0 Å, Crystal structure of Mg-ADP-bound SecA from Bacillus subtilis
2IBM 3.2 Å, A novel dimer interface and conformational changes revealed by an X-ray structure of B.…
8Y9Y 3.29 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+1C)
3IQY 3.3 Å, Active site mutants of B. subtilis SecA
7XHB 3.33 Å, Structure of the SecA/SecYE/proOmpA(4Y)-sfGFP complex with ADP
7XHA 3.35 Å, Structure of the SecA/SecYE/proOmpA(4Y)-sfGFP complex with ADP.BeF3-.
8Y9Z 3.41 Å, Structure of the SecA-SecY complex with the substrate HmBRI-3TM

Browse structure collections

About this viewer

MolViewer shows 3IQM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.