3J9P: PDB entry 3J9P

Structure of the TRPA1 ion channel determined by electron cryo-microscopy. Determined by electron microscopy at 4.24 Å resolution. Released 8 Apr 2015.

Method: Electron microscopy
Resolution: 4.24 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 4
Atoms: 16,952
Mol. weight: 690.3 kDa
Released: 8 Apr 2015

Explore 3J9P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3J9P contains 108 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 27 helices, 0 β-strands

Element	Residues	Length
α-helix	449-456	8
α-helix	459-466	8
α-helix	482	1
α-helix	485-491	7
α-helix	495-504	10
α-helix	517-521	5
α-helix	528-536	9
α-helix	551-555	5
α-helix	561-568	8
α-helix	583-588	6
α-helix	593-601	9
α-helix	621-626	6
α-helix	630-636	7
α-helix	685-690	6
α-helix	701-705	5
α-helix	706-739	34
α-helix	767-782	16
α-helix	804-819	16
α-helix	820-822	3
α-helix	829-849	21
α-helix	859-891	33
α-helix	901-912	12
α-helix	923-928	6
α-helix	934-947	14
α-helix	951-969	19
α-helix	971-987	17
α-helix	1041-1070	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose-binding periplasmic protein, Transient receptor potential cation channel subfamily A…	A, B, C, D	protein	1528	Escherichia coli, Homo sapiens	O75762 (AlphaFold model), P0AEX9 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3J9P_1 Maltose-binding periplasmic protein, Transient receptor potential cation channel subfamily A member 1 chimera (chains A, B, C, D)
MGSSHHHHHHHHGSSMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLE
EKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLI
AYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAAD
GGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAM
TINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYL
LTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVR
TAVINAASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGIEENLYFQGAGSKRSLRKMWRP
GEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCDDMDTFFLHYAA
AEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRGANPNLRNFNM
MAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKP
CKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGD
LEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCHET
MLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIK
DNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNN
LLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAK
NGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTA
LHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKI
FSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTK
KTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLGLI
PMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLIKTCMILVFLSSIFGYCKEAGQ
IFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVYFYWMNFLLYLQ
RFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLSIIQTFSM
MLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIADVQKHA
SLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQ
EIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRF
KKEQMEQRNSRWNTVLRAVKAKTHHLEP

Primary citation

Structure of the TRPA1 ion channel suggests regulatory mechanisms. Paulsen, C.E., Armache, J.-P., Gao, Y. et al. Nature (2015) 520:511-517. DOI 10.1038/nature14367 · PubMed

Other PDB entries of the same protein (UniProt O75762 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HC8 1.9 Å, Factor Inhibiting HIF (FIH) in complex with zinc, NOG and TRPA1 (313-339)
9VU1 2.59 Å, Structure of hTRPA1 complexed with LIQA
6V9V 2.6 Å, Structure of TRPA1 modified by Bodipy-iodoacetamide with bound calcium, LMNG
7OR0 2.64 Å, Cryo-EM structure of the human TRPA1 ion channel in complex with the antagonist 3-60,…
7OR1 2.64 Å, Cryo-EM structure of the human TRPA1 ion channel in complex with the antagonist 3-60,…
9MOE 2.7 Å, Preclinical and clinical evaluation of a novel TRPA1 antagonist LY3526318
6PQQ 2.81 Å, Cryo-EM structure of human TRPA1 C621S mutant in the apo state
6PQO 2.88 Å, Cryo-EM structure of the human TRPA1 ion channel in complex with the covalent agonist…
6X2J 3.0 Å, Structure of human TRPA1 in complex with agonist GNE551
7JUP 3.05 Å, Structure of human TRPA1 in complex with antagonist compound 21
6PQP 3.06 Å, Cryo-EM structure of the human TRPA1 ion channel in complex with the covalent agonist BITC
6V9W 3.1 Å, Structure of TRPA1 (ligand-free) with bound calcium, LMNG

Browse structure collections

About this viewer

MolViewer shows 3J9P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.