3JUI: PDB entry 3JUI

Name: PDB 3JUI: Crystal Structure of the C-terminal Domain of Human Translation Initiation Factor eIF2B epsilon Subunit
Published: 2009-10-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: translation

Crystal Structure of the C-terminal Domain of Human Translation Initiation Factor eIF2B epsilon Subunit. Determined by X-ray diffraction at 2.0 Å resolution. Released 6 Oct 2009.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,547
Mol. weight: 21.48 kDa
Released: 6 Oct 2009

Explore 3JUI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JUI contains 11 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	541-567	27
α-helix	571-584	14
α-helix	589-602	14
α-helix	603-607	5
α-helix	614-635	22
α-helix	639-655	17
α-helix	657-662	6
α-helix	663-672	10
α-helix	678-685	8
α-helix	693-697	5
α-helix	701-714	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Translation initiation factor eIF-2B subunit epsilon	A	protein	182	Homo sapiens	Q13144 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3JUI_1 Translation initiation factor eIF-2B subunit epsilon (chains A)
GHHHHHHMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHV
VLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEAL
GISMAKVLMAFYQLEILAGETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSE
DD

Primary citation

Crystal Structure of the C-terminal Domain of Human Translation Initiation Factor eIF2B epsilon Subunit. Wei, J., Xu, H., Zhang, C. et al. To be published.

Other PDB entries of the same protein (UniProt Q13144 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y4B 2.1 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7VLK 2.27 Å, eIF2B-SFSV NSs C2-imposed
9Y3U 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
9Y4W 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7F64 2.42 Å, eIF2B-SFSV NSs
9Y3T 2.5 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7RLO 2.6 Å, Structure of the human eukaryotic translation initiation factor 2B (eIF2B) in complex…
9HVE 2.7 Å, Native human eIF2-eIF2B complex
7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2
9Y5T 2.78 Å, eIF2B lacking the latch helix bound to ISRACT-02 (Active state)
6CAJ 2.8 Å, Electron cryo-microscopy of the eukaryotic translation initiation factor 2B from Homo…
7L70 2.8 Å, The eukaryotic translation initiation factor 2B from Homo sapiens in its apo form

Browse structure collections

About this viewer

MolViewer shows 3JUI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.