3JZ9: Uncharacterized protein DrrA

Crystal structure of the GEF domain of DrrA/SidM from Legionella pneumophila. Determined by X-ray diffraction at 1.8 Å resolution. Released 19 Jan 2010.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Legionella pneumophila subsp. pneumophila str. Philadelphia 1
Chains: 1
Atoms: 1,786
Mol. weight: 22.39 kDa
Released: 19 Jan 2010

Explore 3JZ9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JZ9 contains 9 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	338-361	24
α-helix	365-381	17
α-helix	386-389	4
α-helix	390-393	4
α-helix	400-419	20
α-helix	428-447	20
α-helix	464-478	15
β-strand	484-485	2	1
β-strand	488-489	2	1
α-helix	490-506	17
α-helix	512-520	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uncharacterized protein DrrA	A	protein	197	Legionella pneumophila subsp. pneumophila str. Philadelphia 1	Q5ZSQ3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3JZ9_1 Uncharacterized protein DrrA (chains A)
GHMVTRIENLENAKKLWDNANSMLEKGNISGYLKAANELHKFMKEKNLKEDDLRPELSDK
TISPKGYAILQSLWGAASDYSRAAATLTESTVEPGLVSAVNKMSAFFMDCKLSPNERATP
DPDFKVGKSKILVGIMQFIKDVADPTSKIWMHNTKALMNHKIAAIQKLERSNNVNDETLE
SVLSSKGENLSEYLSYK

Primary citation

RabGDI displacement by DrrA from Legionella is a consequence of its guanine nucleotide exchange activity. Schoebel, S., Oesterlin, L.K., Blankenfeldt, W. et al. Mol Cell (2009) 36:1060-1072. DOI 10.1016/j.molcel.2009.11.014 · PubMed

Other PDB entries of the same protein (UniProt Q5ZSQ3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WWX 1.5 Å, Crystal structure of the SidM/DrrA(GEF/GDF domain)-Rab1(GTPase domain) complex
3JZA 1.8 Å, Crystal structure of human Rab1b in complex with the GEF domain of DrrA/SidM from…
4MXP 1.83 Å, Structural Basis for PI(4)P-Specific Membrane Recruitment of the Legionella pneumophila…
3N6O 2.5 Å, Crystal structure of the GEF and P4M domain of DrrA/SidM from Legionella pneumophila
3L0I 2.85 Å, Complex structure of SidM/DrrA with the wild type Rab1
3L0M 3.45 Å, Crystal structure of Rab1-activation domain and P4M domain of SidM/DrrA from legionella

Browse structure collections

About this viewer

MolViewer shows 3JZ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.