4MXP: Defects in Rab1 recruitment protein A

Structural Basis for PI(4)P-Specific Membrane Recruitment of the Legionella pneumophila Effector DrrA/SidM. Determined by X-ray diffraction at 1.83 Å resolution. Released 19 Mar 2014.

Method: X-ray diffraction
Resolution: 1.83 Å
Organism: Legionella pneumophila subsp. pneumophila
Chains: 1
Atoms: 2,696
Mol. weight: 37.69 kDa
Ligands: DB4
Released: 19 Mar 2014

Explore 4MXP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MXP contains 18 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	339-361	23
α-helix	365-381	17
α-helix	386-389	4
α-helix	390-393	4
α-helix	400-419	20
α-helix	428-447	20
α-helix	453-454	2
α-helix	464-478	15
β-strand	484-485	2	1
β-strand	488-489	2	1
α-helix	490-506	17
α-helix	512-520	9
α-helix	526-529	4
α-helix	557-559	3
α-helix	564-579	16
α-helix	585-596	12
α-helix	599-605	7
α-helix	610-615	6
α-helix	617-619	3
α-helix	620-645	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Defects in Rab1 recruitment protein A	A	protein	328	Legionella pneumophila subsp. pneumophila	Q5ZSQ3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4MXP_1 Defects in Rab1 recruitment protein A (chains A)
MGHHHHHHGSAKIRELGVQRVTRIENLENAKKLWDNANSMLEKGNISGYLKAANELHKFM
KEKNLKEDDLRPELSDKTISPKGYAILQSLWGAASDYSRAAATLTESTVEPGLVSAVNKM
SAFFMDCKLSPNERATPDPDFKVGKSKILVGIMQFIKDVADPTSKIWMHNTKALMNHKIA
AIQKLERSNNVNDETLESVLSSKGENLSEYLSYKYATKDEGREHRYTASTENFKNVKEKY
QQMRGDALKTEILADFKDKLAEATDEQSLKQIVAELKSKDEYRILAKGQGLTTQLLGLKT
SSVSSFEKMVEETRESIKSQERQTIKIK

Ligands and cofactors

ID	Name	Formula	Copies
DB4	(2R)-3-{[(R)-hydroxy{[(1R,2R,3R,4R,5S,6R)-2,3,5,6-tetrahydroxy-4-(phosphonooxy)…	C17 H32 O16 P2	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Structural Basis for PI(4)P-Specific Membrane Recruitment of the Legionella pneumophila Effector DrrA/SidM. Del Campo, C.M., Mishra, A.K., Wang, Y.H. et al. Structure (2014) 22:397-408. DOI 10.1016/j.str.2013.12.018 · PubMed

Other PDB entries of the same protein (UniProt Q5ZSQ3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WWX 1.5 Å, Crystal structure of the SidM/DrrA(GEF/GDF domain)-Rab1(GTPase domain) complex
3JZ9 1.8 Å, Crystal structure of the GEF domain of DrrA/SidM from Legionella pneumophila
3JZA 1.8 Å, Crystal structure of human Rab1b in complex with the GEF domain of DrrA/SidM from…
3N6O 2.5 Å, Crystal structure of the GEF and P4M domain of DrrA/SidM from Legionella pneumophila
3L0I 2.85 Å, Complex structure of SidM/DrrA with the wild type Rab1
3L0M 3.45 Å, Crystal structure of Rab1-activation domain and P4M domain of SidM/DrrA from legionella

Browse structure collections

About this viewer

MolViewer shows 4MXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.