3JZP: Protein Mdm4

Human MDMX liganded with a 12mer peptide inhibitor (pDI6W). Determined by X-ray diffraction at 1.74 Å resolution. Released 10 Nov 2009.

Method: X-ray diffraction
Resolution: 1.74 Å
Organism: Homo sapiens
Chains: 2
Atoms: 931
Mol. weight: 11.72 kDa
Released: 10 Nov 2009

Explore 3JZP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JZP contains 5 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	26-27	2	1
β-strand	28-29	2	2
α-helix	31-39	9
β-strand	47-48	2	1
α-helix	49-62	14
β-strand	66	1	3
β-strand	73-75	3	3
α-helix	80-85	6
β-strand	89-91	3	3
α-helix	96-105	10
β-strand	106-107	2	2

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	19-24	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein Mdm4	A	protein	89	Homo sapiens	O15151 (AlphaFold model)
pDI6W peptide (12mer)	P	protein	12

Sequence of entity 1 (A), FASTA

>3JZP_1 Protein Mdm4 (chains A)
QINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLG
ELLGRQSFSVKDPSPLYDMLRKNLVTLAT

Sequence of entity 2 (P), FASTA

>3JZP_2 pDI6W peptide (12mer) (chains P)
LTFEHWWAQLTS

Primary citation

Structure-based design of high affinity peptides inhibiting the interaction of p53 with MDM2 and MDMX. Phan, J., Li, Z., Kasprzak, A. et al. J Biol Chem (2010) 285:2174-2183. DOI 10.1074/jbc.M109.073056 · PubMed

Other PDB entries of the same protein (UniProt O15151 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Q9Y 1.2 Å, HDMX (14-111; C17S) COMPLEXED WITH COMPOUND 16 AT 1.20A; Structural states of Hdm2 and…
3FEA 1.33 Å, Crystal Structure of HdmX bound to the p53-peptidomimetic…
3FE7 1.35 Å, Crystal Structure of HdmX bound to the p53-peptidomimetic…
3FDO 1.4 Å, Structure of human MDMX in complex with high affinity peptide
3LBJ 1.5 Å, Structure of human MDMX protein in complex with a small molecule inhibitor
4RXZ 1.55 Å, Crystal Structure of MDMX phosporylated Tyr99 in complex with a 12-mer peptide
6Q9W 1.55 Å, X-ray structure of compound 15 bound to HdmX: Structural states of Hdm2 and HdmX: X-ray…
3EQY 1.63 Å, Crystal structure of human MDMX in complex with a 12-mer peptide inhibitor
7C3Y 1.63 Å, Crystal structure of the N-terminal domain of human MdmX protein in complex with Nutlin3a
7C44 1.65 Å, Crystal structure of the p53-binding domain of human MdmX protein in complex with Nutlin3a
8HDG 1.73 Å, Small peptide enhances the binding of nutline-3a to MdmX
3JZO 1.8 Å, Human MDMX liganded with a 12mer peptide (pDI)

Browse structure collections

About this viewer

MolViewer shows 3JZP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.