3K05: MDC1 BRCT T2067D

The crystal structure of MDC1 BRCT T2067D in complex with a minimal recognition tetrapeptide with an amidated C-terminus. Determined by X-ray diffraction at 1.33 Å resolution. Released 2 Mar 2010.

Method: X-ray diffraction
Resolution: 1.33 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,688
Mol. weight: 45.29 kDa
Released: 2 Mar 2010

Explore 3K05 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3K05 contains 30 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	1894-1897	4	1
α-helix	1903-1911	9
β-strand	1915-1916	2	1
α-helix	1920-1922	3
β-strand	1925-1927	3	1
β-strand	1934	1	2
α-helix	1935-1943	9
β-strand	1947-1948	2	1
α-helix	1950-1959	10
α-helix	1962-1964	3
α-helix	1966-1968	3
β-strand	1969	1	1
α-helix	1973-1979	7
α-helix	1983-1992	10
β-strand	2000-2003	4	3
α-helix	2011-2020	10
α-helix	2023	1
β-strand	2024-2026	3	3
β-strand	2037-2040	4	3
α-helix	2043-2048	6
α-helix	2050-2055	6
α-helix	2057-2058	2
β-strand	2059-2060	2	3
α-helix	2063-2071	9
α-helix	2076-2079	4
β-strand	2080	1	3
α-helix	2081-2082	2

Chain B: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	1894-1897	4	4
α-helix	1903-1911	9
β-strand	1915-1916	2	4
α-helix	1920-1922	3
β-strand	1925-1928	4	4
β-strand	1934	1	5
α-helix	1935-1943	9
β-strand	1947-1949	3	4
α-helix	1951-1959	9
α-helix	1962-1964	3
α-helix	1966-1968	3
β-strand	1969	1	4
α-helix	1973-1979	7
α-helix	1983-1992	10
β-strand	2000-2003	4	6
α-helix	2011-2020	10
β-strand	2024-2026	3	6
β-strand	2037-2040	4	6
α-helix	2043-2049	7
α-helix	2050-2055	6
β-strand	2059-2060	2	6
α-helix	2063-2071	9
α-helix	2076-2078	3
β-strand	2080	1	6
α-helix	2081-2082	2

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	141	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mediator of DNA damage checkpoint protein 1	A, B	protein	200	Homo sapiens	Q14676 (AlphaFold model)
phospho peptide	C, D	protein	5

Sequence of entity 1 (A, B), FASTA

>3K05_1 Mediator of DNA damage checkpoint protein 1 (chains A, B)
GTAPKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILS
LDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQP
PPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLDGV
LKQEAKPEAFVLSPLEMSST

Sequence of entity 2 (C, D), FASTA

>3K05_2 phospho peptide (chains C, D)
SQEYX

Primary citation

Comparison of the Structures and Peptide Binding Specificities of the BRCT Domains of MDC1 and BRCA1. Campbell, S.J., Edwards, R.A., Glover, J.N. Structure (2010) 18:167-176. DOI 10.1016/j.str.2009.12.008 · PubMed

Other PDB entries of the same protein (UniProt Q14676 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ETX 1.33 Å, Crystal Structure of MDC1 Tandem BRCT Domains
2ADO 1.45 Å, Crystal Structure Of The Brct Repeat Region From The Mediator of DNA damage checkpoint…
3UMZ 1.65 Å, Crystal Structure of the human MDC1 FHA Domain
3UNN 1.7 Å, Monomeric structure of the human MDC1 FHA domain in complex with an MDC1 phospho-T4…
3UNM 1.8 Å, Crystal Structure of The Human MDC1 FHA Domain
3UOT 1.8 Å, Crystal Structure of MDC1 FHA Domain in Complex with a Phosphorylated Peptide from the…
3UN0 2.3 Å, Crystal Structure of MDC1 FHA Domain
9QJZ 2.31 Å, Crystal structure of ARC4 from human Tankyrase 2 in complex with phosphorylated peptide…
2AZM 2.41 Å, Crystal structure of the MDC1 brct repeat in complex with the histone tail of gamma-H2AX
9IF9 2.55 Å, Crystal structure of the Pellino 1 FHA domain in complex with a MDC1-TQxF phosphopeptide.
3UEO 2.6 Å, Crystal structure of TopBP1 BRCT4/5 domains in complex with a phospho-peptide

Browse structure collections

About this viewer

MolViewer shows 3K05 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.