3KCI: The third RLD domain of HERC2

The third RLD domain of HERC2. Determined by X-ray diffraction at 1.8 Å resolution. Released 3 Nov 2009.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,139
Mol. weight: 41.12 kDa
Released: 3 Nov 2009

Explore 3KCI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KCI contains 12 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	3954-3959	6	1
β-strand	3972-3978	7	1
α-helix	3980-3984	5
β-strand	3987-3993	7	2
β-strand	3996-4001	6	2
β-strand	4006-4010	5	2
α-helix	4013-4015	3
β-strand	4025-4030	6	2
α-helix	4032-4034	3
β-strand	4039-4044	6	3
β-strand	4050-4055	6	3
β-strand	4060-4064	5	3
α-helix	4067-4069	3
β-strand	4079-4084	6	3
α-helix	4086-4088	3
β-strand	4093-4098	6	4
β-strand	4102-4107	6	4
β-strand	4112-4116	5	4
α-helix	4119-4121	3
β-strand	4131-4136	6	4
α-helix	4138-4140	3
β-strand	4145-4150	6	5
β-strand	4156-4161	6	5
β-strand	4165-4170	6	5
α-helix	4173-4175	3
β-strand	4185-4190	6	5
α-helix	4192-4194	3
β-strand	4199-4205	7	6
β-strand	4208-4213	6	6
β-strand	4218-4222	5	6
α-helix	4225-4227	3
β-strand	4237-4242	6	6
α-helix	4244-4246	3
β-strand	4251-4256	6	7
β-strand	4260-4265	6	7
β-strand	4270-4274	5	7
β-strand	4289-4294	6	7
α-helix	4296-4298	3
β-strand	4305-4309	5	1
β-strand	4312-4316	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Probable E3 ubiquitin-protein ligase HERC2	A	protein	389	Homo sapiens	O95714

Sequence of entity 1 (A), FASTA

>3KCI_1 Probable E3 ubiquitin-protein ligase HERC2 (chains A)
MHHHHHHSSGRENLYFQGSGTIYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIG
GEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCL
ALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDL
YTWGKGRYGRLGHSDSEDQLKPKLVEALQGHRVVDIACGSGDAQTLCLTDDDTVWSWGDG
DYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHG
SDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRP
RLVAALQGKKVNRVACGSAHTLAWSTSKP

Primary citation

Structure of the Third RLD Domain of Herc2. Walker, J.R., Qiu, L., Vesterberg, A. et al. To be published.

Other PDB entries of the same protein (UniProt O95714), best resolution first:

9L93 1.73 Å, Crystal structure of NCOA4 in complex with HERC2
9L8Y 1.92 Å, Crystal structure of HERC2
7Q42 1.95 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
7RGW 1.99 Å, Crystal structure of HERC2 DOC domain
6WW3 2.1 Å, Crystal structure of HERC2 ZZ domain in complex with SUMO1 tail
7Q45 2.1 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
7Q44 2.2 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
6WW4 2.25 Å, Crystal structure of HERC2 ZZ domain in complex with histone H3 tail
7Q40 2.35 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2
7Q43 2.4 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
7Q46 2.46 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
4L1M 2.6 Å, Structure of the first RCC1-like domain of HERC2

Browse structure collections

About this viewer

MolViewer shows 3KCI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.