7RGW: HERC2 DOC domain

Crystal structure of HERC2 DOC domain. Determined by X-ray diffraction at 1.99 Å resolution. Released 20 Jul 2022.

Method: X-ray diffraction
Resolution: 1.99 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,287
Mol. weight: 19.69 kDa
Released: 20 Jul 2022

Explore 7RGW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RGW contains 6 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2778-2779	2	1
α-helix	2782-2785	4
β-strand	2786-2791	6	2
α-helix	2795-2797	3
α-helix	2800-2803	4
α-helix	2808	1
β-strand	2809-2810	2	3
β-strand	2818-2824	7	2
β-strand	2828-2836	9	1
α-helix	2839-2844	6
β-strand	2846-2854	9	2
β-strand	2861-2867	7	2
β-strand	2874-2879	6	1
β-strand	2887-2895	9	2
α-helix	2896-2898	3
β-strand	2903-2904	2	3
β-strand	2906-2913	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase HERC2	A	protein	174	Homo sapiens	O95714

Sequence of entity 1 (A), FASTA

>7RGW_1 E3 ubiquitin-protein ligase HERC2 (chains A)
MHHHHHHSSGRENLYFQGFCGRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASR
LIDGSEPCWQSSGSQGKHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNL
IELKTININPSDTTVPLLNDCTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIR

Primary citation

The ZZ domain of HERC2 is a receptor of arginylated substrates. Tencer, A.H., Liu, J., Zhu, J. et al. Sci Rep (2022) 12:6063-6063. DOI 10.1038/s41598-022-10119-w · PubMed

Other PDB entries of the same protein (UniProt O95714), best resolution first:

9L93 1.73 Å, Crystal structure of NCOA4 in complex with HERC2
3KCI 1.8 Å, The third RLD domain of HERC2
9L8Y 1.92 Å, Crystal structure of HERC2
7Q42 1.95 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
6WW3 2.1 Å, Crystal structure of HERC2 ZZ domain in complex with SUMO1 tail
7Q45 2.1 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
7Q44 2.2 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
6WW4 2.25 Å, Crystal structure of HERC2 ZZ domain in complex with histone H3 tail
7Q40 2.35 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2
7Q43 2.4 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
7Q46 2.46 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
4L1M 2.6 Å, Structure of the first RCC1-like domain of HERC2

Browse structure collections

About this viewer

MolViewer shows 7RGW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.