Crystal structure of HERC2 ZZ domain in complex with histone H3 tail. Determined by X-ray diffraction at 2.25 Å resolution. Released 5 Aug 2020.
Explore 6WW4 in 3D Show helices and sheets RCSB PDB PDBe
6WW4 contains 3 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-6 | 4 | |
| β-strand | 2702-2703 | 2 | 3 |
| β-strand | 2716-2717 | 2 | 3 |
| β-strand | 2720-2723 | 4 | 4 |
| β-strand | 2730-2731 | 2 | 4 |
| α-helix | 2733-2738 | 6 | |
| β-strand | 2747-2750 | 4 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2702-2703 | 2 | 1 |
| β-strand | 2716-2717 | 2 | 1 |
| β-strand | 2720-2723 | 4 | 2 |
| β-strand | 2730-2731 | 2 | 2 |
| α-helix | 2733-2738 | 6 | |
| β-strand | 2747-2750 | 4 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone H3.1,E3 ubiquitin-protein ligase HERC2 | A, B | protein | 56 | Homo sapiens | O95714, P68431 (AlphaFold model) |
>6WW4_1 Histone H3.1,E3 ubiquitin-protein ligase HERC2 (chains A, B) ARTKQTIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRIN
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
Water and common crystallization additives (GOL) are not listed.
Structural Insight into Binding of the ZZ Domain of HERC2 to Histone H3 and SUMO1. Liu, J., Xue, Z., Zhang, Y. et al. Structure (2020) 28:1225-1230.e3. DOI 10.1016/j.str.2020.07.003 · PubMed
Other PDB entries of the same protein (UniProt O95714), best resolution first:
MolViewer shows 6WW4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.