Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with DXDKDED motif of pericentriolar material 1 protein. Determined by X-ray diffraction at 2.46 Å resolution. Released 16 Nov 2022.
Explore 7Q46 in 3D Show helices and sheets RCSB PDB PDBe
7Q46 contains 36 α-helices and 84 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2961-2966 | 6 | 1 |
| β-strand | 2979-2985 | 7 | 1 |
| α-helix | 2987-2992 | 6 | |
| β-strand | 2994-3000 | 7 | 2 |
| β-strand | 3003-3008 | 6 | 2 |
| β-strand | 3013-3018 | 6 | 2 |
| α-helix | 3020-3022 | 3 | |
| β-strand | 3032-3038 | 7 | 2 |
| α-helix | 3040-3042 | 3 | |
| β-strand | 3047-3052 | 6 | 3 |
| β-strand | 3058-3063 | 6 | 3 |
| β-strand | 3068-3072 | 5 | 3 |
| α-helix | 3075-3077 | 3 | |
| β-strand | 3087-3092 | 6 | 3 |
| α-helix | 3094-3096 | 3 | |
| β-strand | 3101-3106 | 6 | 4 |
| β-strand | 3110-3115 | 6 | 4 |
| β-strand | 3120-3124 | 5 | 4 |
| α-helix | 3127-3129 | 3 | |
| β-strand | 3139-3144 | 6 | 4 |
| α-helix | 3146-3148 | 3 | |
| β-strand | 3153-3158 | 6 | 5 |
| β-strand | 3164-3169 | 6 | 5 |
| β-strand | 3174-3178 | 5 | 5 |
| α-helix | 3181-3183 | 3 | |
| β-strand | 3193-3198 | 6 | 5 |
| α-helix | 3200-3202 | 3 | |
| β-strand | 3207-3212 | 6 | 6 |
| β-strand | 3216-3221 | 6 | 6 |
| β-strand | 3226-3230 | 5 | 6 |
| α-helix | 3233-3235 | 3 | |
| β-strand | 3245-3250 | 6 | 6 |
| α-helix | 3252-3254 | 3 | |
| β-strand | 3259-3264 | 6 | 7 |
| β-strand | 3268-3273 | 6 | 7 |
| β-strand | 3278-3282 | 5 | 7 |
| β-strand | 3297-3302 | 6 | 7 |
| α-helix | 3303 | 1 | |
| β-strand | 3311-3316 | 6 | 1 |
| β-strand | 3320-3325 | 6 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2961-2966 | 6 | 8 |
| β-strand | 2979-2985 | 7 | 8 |
| α-helix | 2987-2991 | 5 | |
| β-strand | 2994-3000 | 7 | 9 |
| β-strand | 3003-3008 | 6 | 9 |
| β-strand | 3013-3018 | 6 | 9 |
| α-helix | 3020-3022 | 3 | |
| β-strand | 3032-3038 | 7 | 9 |
| α-helix | 3040-3042 | 3 | |
| β-strand | 3047-3052 | 6 | 10 |
| β-strand | 3058-3063 | 6 | 10 |
| β-strand | 3068-3072 | 5 | 10 |
| α-helix | 3075-3077 | 3 | |
| β-strand | 3087-3092 | 6 | 10 |
| α-helix | 3094-3096 | 3 | |
| β-strand | 3101-3106 | 6 | 11 |
| β-strand | 3110-3115 | 6 | 11 |
| β-strand | 3120-3124 | 5 | 11 |
| α-helix | 3127-3129 | 3 | |
| β-strand | 3139-3144 | 6 | 11 |
| α-helix | 3146-3148 | 3 | |
| β-strand | 3153-3158 | 6 | 12 |
| β-strand | 3164-3169 | 6 | 12 |
| β-strand | 3174-3178 | 5 | 12 |
| α-helix | 3181-3183 | 3 | |
| β-strand | 3193-3198 | 6 | 12 |
| α-helix | 3200-3202 | 3 | |
| β-strand | 3207-3212 | 6 | 13 |
| β-strand | 3216-3221 | 6 | 13 |
| β-strand | 3226-3230 | 5 | 13 |
| α-helix | 3233-3235 | 3 | |
| β-strand | 3245-3250 | 6 | 13 |
| α-helix | 3252-3254 | 3 | |
| β-strand | 3259-3264 | 6 | 14 |
| β-strand | 3268-3273 | 6 | 14 |
| β-strand | 3278-3282 | 5 | 14 |
| β-strand | 3297-3302 | 6 | 14 |
| α-helix | 3303 | 1 | |
| β-strand | 3313-3316 | 4 | 8 |
| β-strand | 3320-3324 | 5 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2961-2966 | 6 | 15 |
| β-strand | 2979-2985 | 7 | 15 |
| α-helix | 2987-2990 | 4 | |
| β-strand | 2994-3000 | 7 | 16 |
| β-strand | 3003-3008 | 6 | 16 |
| β-strand | 3013-3018 | 6 | 16 |
| α-helix | 3020-3022 | 3 | |
| β-strand | 3032-3038 | 7 | 16 |
| α-helix | 3040-3042 | 3 | |
| β-strand | 3047-3051 | 5 | 17 |
| β-strand | 3058-3063 | 6 | 17 |
| β-strand | 3068-3072 | 5 | 17 |
| α-helix | 3075-3077 | 3 | |
| β-strand | 3087-3092 | 6 | 17 |
| α-helix | 3094-3096 | 3 | |
| β-strand | 3101-3106 | 6 | 18 |
| β-strand | 3110-3115 | 6 | 18 |
| β-strand | 3120-3124 | 5 | 18 |
| α-helix | 3127-3129 | 3 | |
| β-strand | 3139-3144 | 6 | 18 |
| α-helix | 3146-3148 | 3 | |
| β-strand | 3153-3158 | 6 | 19 |
| β-strand | 3164-3169 | 6 | 19 |
| β-strand | 3174-3178 | 5 | 19 |
| α-helix | 3181-3183 | 3 | |
| β-strand | 3193-3198 | 6 | 19 |
| α-helix | 3200-3202 | 3 | |
| β-strand | 3207-3212 | 6 | 20 |
| β-strand | 3216-3221 | 6 | 20 |
| β-strand | 3226-3230 | 5 | 20 |
| α-helix | 3233-3235 | 3 | |
| β-strand | 3245-3250 | 6 | 20 |
| α-helix | 3252-3254 | 3 | |
| β-strand | 3259-3264 | 6 | 21 |
| β-strand | 3268-3273 | 6 | 21 |
| β-strand | 3278-3282 | 5 | 21 |
| β-strand | 3297-3302 | 6 | 21 |
| α-helix | 3303 | 1 | |
| β-strand | 3313-3316 | 4 | 15 |
| β-strand | 3320-3324 | 5 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase HERC2 | A, C, E | protein | 405 | Homo sapiens | O95714 |
| Pericentriolar material 1 protein | B, D, F | protein | 15 | Homo sapiens | Q15154 (AlphaFold model) |
>7Q46_1 E3 ubiquitin-protein ligase HERC2 (chains A, C, E) GAMGSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQV AGGSKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSSYVVKKVAVHSGGR HATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSS GELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSW GDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRL GHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTTTVN RKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQT
>7Q46_2 Pericentriolar material 1 protein (chains B, D, F) DEDKDKDETETVKQT
| ID | Name | Formula | Copies |
|---|---|---|---|
| CIT | Citric acid | C6 H8 O7 | 1 |
Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with DXDKDED motif of pericentriolar material 1 protein. Demenge, A., Howard, E., Cousido-Siah, A. et al. To be published.
Other PDB entries of the same protein (UniProt O95714), best resolution first:
MolViewer shows 7Q46 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.