3KJO: HPOT1V2-dTrUd(AGGGTTAG)

Crystal Structure of hPOT1V2-dTrUd(AGGGTTAG). Determined by X-ray diffraction at 1.8 Å resolution. Released 19 Jan 2010.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,739
Mol. weight: 36.84 kDa
Released: 19 Jan 2010

Explore 3KJO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KJO contains 12 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	21-37	17	1
β-strand	43-50	8	1
β-strand	56-63	8	1
α-helix	66-68	3
β-strand	78-89	12	1
β-strand	92-106	15	1
β-strand	117	1	1
α-helix	127-143	17
α-helix	153-155	3
β-strand	161-173	13	2
β-strand	178-184	7	2
α-helix	192	1
β-strand	193	1	2
α-helix	194	1
β-strand	204-205	2	2
α-helix	207-213	7
α-helix	214-216	3
β-strand	218-223	6	2
α-helix	226-232	7
α-helix	233-234	2
β-strand	238-251	14	2
β-strand	257-265	9	2
α-helix	270-272	3
β-strand	274-278	5	2
α-helix	279	1
α-helix	283-297	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protection of telomeres protein 1	A	protein	299	Homo sapiens	Q9NUX5 (AlphaFold model)
Dna/rna (5'-d(t)-r(pu)-d(papgpgpgptptpapg)-3')	B	NA-hybrid	10

Sequence of entity 1 (A), FASTA

>3KJO_1 Protection of telomeres protein 1 (chains A)
MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCL
LFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLTFEGTLGAPIIPRTSS
KYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFL
LKVWDGTRTPFPSWRVLIQDLVLEGDLSHIHRLQNLTIDILVYDNHVHVARSLKVGSFLR
IYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTA

Sequence of entity 2 (B), FASTA

>3KJO_2 DNA/RNA (5'-D(*T)-R(P*U)-D(P*AP*GP*GP*GP*TP*TP*AP*G)-3') (chains B)
TUAGGGTTAG

Primary citation

How telomeric protein POT1 avoids RNA to achieve specificity for single-stranded DNA. Nandakumar, J., Podell, E.R., Cech, T.R. Proc Natl Acad Sci U S A (2010) 107:651-656. DOI 10.1073/pnas.0911099107 · PubMed

Other PDB entries of the same protein (UniProt Q9NUX5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1XJV 1.73 Å, Crystal structure of human POT1 bound to telomeric single-stranded DNA (TTAGGGTTAG)
3KJP 1.8 Å, Crystal Structure of hPOT1V2-GGTTAGGGTTAG
5H65 2.1 Å, Crystal structure of human POT1 and TPP1
5UN7 2.1 Å, Structure of the human POT1-TPP1 telomeric complex
8SH0 2.16 Å, Structure of human POT1 DNA binding domain bound to a 5'-phosphorylated junction of a…
7S1O 2.55 Å, Structure of human POT1C
7S1U 2.55 Å, Structure of human POT1C
8SH1 2.6 Å, Structure of human POT1 DNA binding domain bound to a 5'-phosphorylated junction of a…
7S1T 2.9 Å, Structure of the human POT1-TPP1 complex
8SOJ 3.8 Å, Cryo-EM structure of human CST bound to POT1(ESDL)/TPP1 in the absence of telomeric ssDNA
7QXB 3.9 Å, Cryo-EM map of human telomerase-DNA-TPP1-POT1 complex (sharpened map)
7QXS 3.9 Å, Cryo-EM structure of human telomerase-DNA-TPP1-POT1 complex (with POT1 side chains)

Browse structure collections

About this viewer

MolViewer shows 3KJO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.