3KPE: Fusion glycoprotein F0

Solution structure of the respiratory syncytial virus (RSV)six-helix bundle complexed with TMC353121, a small-moleucule inhibitor of RSV. Determined by X-ray diffraction at 1.47 Å resolution. Released 22 Dec 2009.

Method: X-ray diffraction
Resolution: 1.47 Å
Organism: Human respiratory syncytial virus
Chains: 2
Atoms: 760
Mol. weight: 10.66 kDa
Ligands: TM3
Released: 22 Dec 2009

Explore 3KPE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KPE contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	160-198	39
α-helix	199-203	5
α-helix	204-206	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	487-514	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion glycoprotein F0	A	protein	51	Human respiratory syncytial virus	P03420
Fusion glycoprotein F0	B	protein	39	Human respiratory syncytial virus	P03420

Sequence of entity 1 (A), FASTA

>3KPE_1 Fusion glycoprotein F0 (chains A)
HLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNK

Sequence of entity 2 (B), FASTA

>3KPE_2 Fusion glycoprotein F0 (chains B)
VFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGK

Ligands and cofactors

ID	Name	Formula	Copies
TM3	2-[[6-[[[2-(3-hydroxypropyl)-5-methylphenyl]amino]methyl]-2-[[3-(4-morpholinyl)…	C32 H42 N6 O3	1

Water and common crystallization additives (PG4) are not listed.

Primary citation

Binding of a potent small-molecule inhibitor of six-helix bundle formation requires interactions with both heptad-repeats of the RSV fusion protein. Roymans, D., De Bondt, H.L., Arnoult, E. et al. Proc Natl Acad Sci U S A (2010) 107:308-313. DOI 10.1073/pnas.0910108106 · PubMed

Other PDB entries of the same protein (UniProt P03420), best resolution first:

29QJ 1.32 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex…
6OJ7 1.45 Å, Respiratory syncytial virus fusion glycoprotein N-terminal heptad repeat domain+VIQKI…
9RA5 1.63 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex…
3O41 1.95 Å, Crystal Structure of 101F Fab Bound to 15-mer Peptide Epitope
9VWE 2.06 Å, Cryo-EM structure of RSV pre-F (strain A2) in complex with Fabs 1A2 and 2D10
6VKE 2.1 Å, Crystal Structure of Inhibitor JNJ-40012665 in Complex with Prefusion RSV F Glycoprotein
7LVW 2.1 Å, Structure of RSV F in Complex with VHH Cl184
6NTX 2.2 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain+VIQKI
8DG9 2.24 Å, Cryo-EM Structure of RSV prefusion F trimer in complex with three MxR Fabs
8PHI 2.29 Å, Crystal structure of prefusion-stabilized RSV F Variant DS-Cav1 in complex with Lonafarnib
5C69 2.3 Å, Crystal Structure of Prefusion-stabilized RSV F variant PR-DM
5EA4 2.3 Å, Crystal Structure of Inhibitor JNJ-49153390 in Complex with Prefusion RSV F Glycoprotein

Browse structure collections

About this viewer

MolViewer shows 3KPE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.