Structure of the N-terminal BRCT domain of human microcephalin (MCPH1). Determined by X-ray diffraction at 1.6 Å resolution. Released 15 Dec 2009.
Explore 3KTF in 3D Show helices and sheets RCSB PDB PDBe
3KTF contains 12 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-15 | 6 | 1 |
| β-strand | 16 | 1 | 2 |
| β-strand | 23 | 1 | 2 |
| α-helix | 25-34 | 10 | |
| β-strand | 38-39 | 2 | 1 |
| β-strand | 49-53 | 5 | 1 |
| α-helix | 57-66 | 10 | |
| β-strand | 69-71 | 3 | 1 |
| α-helix | 73-82 | 10 | |
| α-helix | 88-90 | 3 | |
| β-strand | 92 | 1 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-15 | 6 | 5 |
| β-strand | 16 | 1 | 6 |
| β-strand | 23 | 1 | 6 |
| α-helix | 26-34 | 9 | |
| β-strand | 38-40 | 3 | 5 |
| β-strand | 49-53 | 5 | 5 |
| α-helix | 57-66 | 10 | |
| β-strand | 69-71 | 3 | 5 |
| α-helix | 73-82 | 10 | |
| α-helix | 88-90 | 3 | |
| β-strand | 92 | 1 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Microcephalin | A, B, C | protein | 103 | Homo sapiens | Q8NEM0 (AlphaFold model) |
>3KTF_1 Microcephalin (chains A, B, C) GHMAAPILKDVVAYVEVWSSNGTENYSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQS TWDKAQKRGVKLVSVLWVEKCRTAGAHIDESLFPAANMNEHLS
Structure of N-terminal BRCT domain of human microcephalin (MCPH1). Singh, N., Heroux, A., Thompson, J.R. et al. To be published.
Other PDB entries of the same protein (UniProt Q8NEM0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3KTF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.