3T1N: Human MICROCEPHALIN (MCPH1) TANDEM BRCT domains

Structure of human MICROCEPHALIN (MCPH1) TANDEM BRCT domains in complex with a CDC27 phosphopeptide. Determined by X-ray diffraction at 2.6 Å resolution. Released 30 Nov 2011.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,108
Mol. weight: 45.05 kDa
Released: 30 Nov 2011

Explore 3T1N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3T1N contains 19 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	649-653	5	1
α-helix	657-670	14
β-strand	674	1	1
β-strand	683-688	6	1
β-strand	694	1	2
α-helix	695-703	9
β-strand	706-709	4	1
α-helix	711-719	9
α-helix	726-728	3
β-strand	729	1	1
α-helix	737-745	9
α-helix	755-758	4
β-strand	761-764	4	3
α-helix	772-782	11
β-strand	785-786	2	3
α-helix	790-792	3
β-strand	795-797	3	3
β-strand	809-811	3	3
α-helix	813-822	10
α-helix	828-830	3
β-strand	832	1	3

Chain B: 9 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	649-653	5	4
α-helix	657-670	14
β-strand	674-676	3	4
β-strand	683-688	6	4
β-strand	694	1	5
α-helix	695-703	9
β-strand	706-708	3	4
α-helix	711-718	8
α-helix	726-728	3
β-strand	729	1	4
α-helix	736-746	11
α-helix	760-761	2
β-strand	762-764	3	6
α-helix	772-781	10
β-strand	786-787	2	6
β-strand	795-797	3	6
β-strand	809-811	3	6
α-helix	813-821	9
α-helix	828-830	3
β-strand	832	1	6

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	823	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microcephalin	A, B	protein	199	Homo sapiens	Q8NEM0 (AlphaFold model)
Cdc27 peptide	C, D	protein	4	Homo sapiens	P30260 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3T1N_1 Microcephalin (chains A, B)
GHMSGRGKKPTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLN
VLLGIARGCWVLSYDWVLWSLELGHWISEEPFELSHHFPAAPLCRSECHLSAGPYRGTLF
ADQPVMFVSPASSPPVAKLCELVHLCGGRVSQVPRQASIVIGPYSGKKKATVKYLSEKWV
LDSITQHKVCAPENYLLSQ

Sequence of entity 2 (C, D), FASTA

>3T1N_2 Cdc27 peptide (chains C, D)
SDEF

Primary citation

Molecular Basis for the Association of Microcephalin (MCPH1) Protein with the Cell Division Cycle Protein 27 (Cdc27) Subunit of the Anaphase-promoting Complex. Singh, N., Wiltshire, T.D., Thompson, J.R. et al. J Biol Chem (2012) 287:2854-2862. DOI 10.1074/jbc.M111.307868 · PubMed

Other PDB entries of the same protein (UniProt Q8NEM0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PA6 1.5 Å, Structure of the N-terminal BRCT domain of human microcephalin (MCPH1)
3U3Z 1.5 Å, Structure of human microcephalin (MCPH1) tandem BRCT domains in complex with an H2A.X…
2WT8 1.6 Å, Structure of the N-terminal BRCT domain of human microcephalin (Mcph1)
3KTF 1.6 Å, Structure of the N-terminal BRCT domain of human microcephalin (MCPH1).
3SHT 1.95 Å, Crystal structure of human MCPH1 tandem BRCT domains
3SHV 2.1 Å, Crystal structure of human MCPH1 tandem BRCT domains-gamma H2AX complex
7C5D 2.15 Å, Crystal structure of TRF2 TRFH domain in complex with a MCPH1 peptide
3SZM 2.63 Å, Structure of human microcephalin (MCPH1) tandem brct domains in complex with a…

Browse structure collections

About this viewer

MolViewer shows 3T1N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.