3KTR: Ataxin-2 recognition by poly(A)-binding protein

Structural basis of ataxin-2 recognition by poly(A)-binding protein. Determined by X-ray diffraction at 1.7 Å resolution. Released 23 Feb 2010.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 786
Mol. weight: 11.67 kDa
Ligands: CD
Released: 23 Feb 2010

Explore 3KTR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KTR contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	547-551	5
α-helix	555-573	19
α-helix	578-585	8
α-helix	590-598	9
α-helix	600-622	23

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	918-921	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polyadenylate-binding protein 1	A	protein	88	Homo sapiens	P11940 (AlphaFold model)
Ataxin-2	B	protein	17	Homo sapiens	Q99700 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3KTR_1 Polyadenylate-binding protein 1 (chains A)
GPLGSPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLE
SPESLRSKVDEAVAVLQAHQAKEAAQKA

Sequence of entity 2 (B), FASTA

>3KTR_2 Ataxin-2 (chains B)
STLNPNAKEFNPRSFSQ

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structural basis of binding of P-body-associated proteins GW182 and ataxin-2 by the Mlle domain of poly(A)-binding protein. Kozlov, G., Safaee, N., Rosenauer, A. et al. J Biol Chem (2010) 285:13599-13606. DOI 10.1074/jbc.M109.089540 · PubMed

Other PDB entries of the same protein (UniProt P11940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KUJ 1.4 Å, Crystal structure of C-terminal domain of PABPC1 in complex with binding region of eRF3a
3KUS 1.4 Å, Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the…
2X04 1.49 Å, Crystal structure of the PABC-TNRC6C complex
3KTP 1.5 Å, Structural basis of GW182 recognition by poly(A)-binding protein
3KUT 1.5 Å, Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the…
3PTH 1.7 Å, The PABC1 MLLE domain bound to the variant PAM2 motif of LARP4B
3PKN 1.8 Å, Crystal structure of MLLE domain of poly(A) binding protein in complex with PAM2 motif…
4F25 1.9 Å, Crystal structure of the second RRM domain of human PABPC1 at pH 6.0
5DX1 1.93 Å, Crystal structure of CARM1, sinefungin, and PABP1 peptide (R455)
7BN3 1.93 Å, Crystal structure of C-terminal domain of PABPC1 in complex with Nucleoprotein from…
5DX8 1.94 Å, Crystal structure of CARM1, sinefungin, and methylated PABP1 peptide (R455)
4F02 2.0 Å, Crystal structure of the PABP-binding site of eIF4G in complex with RRM1-2 of PABP and…

Browse structure collections

About this viewer

MolViewer shows 3KTR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.