3KUI: C-terminal domain of PABPC1

Crystal structure of C-terminal domain of PABPC1 in complex with binding region of eRF3a. Determined by X-ray diffraction at 2.3 Å resolution. Released 12 May 2010.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 729
Mol. weight: 11.32 kDa
Ligands: ZN
Released: 12 May 2010

Explore 3KUI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KUI contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	547-552	6
α-helix	555-573	19
α-helix	578-585	8
α-helix	590-596	7
α-helix	600-623	24

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	73-76	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polyadenylate-binding protein 1	A	protein	88	Homo sapiens	P11940 (AlphaFold model)
GSPT1 protein	B	protein	15	Homo sapiens	P15170 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3KUI_1 Polyadenylate-binding protein 1 (chains A)
GPLGSPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLE
SPESLRSKVDEAVAVLQAHQAKEAAQKA

Sequence of entity 2 (B), FASTA

>3KUI_2 GSPT1 protein (chains B)
RQLNVNAKPFVPNVH

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Molecular basis of eRF3 recognition by the MLLE domain of poly(A)-binding protein. Kozlov, G., Gehring, K. PLoS One (2010) 5:e10169-e10169. DOI 10.1371/journal.pone.0010169 · PubMed

Other PDB entries of the same protein (UniProt P11940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KUJ 1.4 Å, Crystal structure of C-terminal domain of PABPC1 in complex with binding region of eRF3a
3KUS 1.4 Å, Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the…
2X04 1.49 Å, Crystal structure of the PABC-TNRC6C complex
3KTP 1.5 Å, Structural basis of GW182 recognition by poly(A)-binding protein
3KUT 1.5 Å, Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the…
3KTR 1.7 Å, Structural basis of ataxin-2 recognition by poly(A)-binding protein
3PTH 1.7 Å, The PABC1 MLLE domain bound to the variant PAM2 motif of LARP4B
3PKN 1.8 Å, Crystal structure of MLLE domain of poly(A) binding protein in complex with PAM2 motif…
4F25 1.9 Å, Crystal structure of the second RRM domain of human PABPC1 at pH 6.0
5DX1 1.93 Å, Crystal structure of CARM1, sinefungin, and PABP1 peptide (R455)
7BN3 1.93 Å, Crystal structure of C-terminal domain of PABPC1 in complex with Nucleoprotein from…
5DX8 1.94 Å, Crystal structure of CARM1, sinefungin, and methylated PABP1 peptide (R455)

Browse structure collections

About this viewer

MolViewer shows 3KUI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.