3KUQ: DLC1 RhoGAP domain

Crystal structure of the DLC1 RhoGAP domain. Determined by X-ray diffraction at 2.3 Å resolution. Released 26 Jan 2010.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,542
Mol. weight: 26.04 kDa
Released: 26 Jan 2010

Explore 3KUQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KUQ contains 11 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	1070	1	1
α-helix	1080-1087	8
α-helix	1093-1105	13
α-helix	1119-1129	11
β-strand	1131	1	1
α-helix	1143-1156	14
α-helix	1166-1176	11
α-helix	1179-1181	3
α-helix	1182-1191	10
α-helix	1195-1213	19
α-helix	1215-1218	4
α-helix	1222-1234	13
α-helix	1260-1278	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rho GTPase-activating protein 7	A	protein	228	Homo sapiens	Q96QB1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3KUQ_1 Rho GTPase-activating protein 7 (chains A)
MHHHHHHSSGRENLYFQGSVFGVPLTVNVQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRK
SGVKSRIQALRQMNEGAIDCVNYEGQSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQ
YVPKDQRLQAIKAAIMLLPDENREVLQTLLYFLSDVTAAVKENQMTPTNLAVCLAPSLFH
LNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGLAHMIAECKKL

Primary citation

Crystal structure of the DLC1 RhoGAP domain. Nedyalkova, L., Tempel, W., Tong, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q96QB1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FZT 2.1 Å, The crystal structure of R7R8 in complex with a DLC1 fragment.
7TPB 3.2 Å, p120RasGAP SH3 domain in complex with DLC1 RhoGAP domain
2DKY Solution structure of the SAM-domain of Rho-GTPase-activating protein 7
2GYT Solution structure of the SAM (sterile alpha motif) domain of DLC1 (deleted in liver…
2KAP Solution structure of DLC1-SAM
2LOZ The novel binding mode of DLC1 and Tensin2 PTB domain

Browse structure collections

About this viewer

MolViewer shows 3KUQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.