Human DNA Ligase III Recognizes DNA Ends by Dynamic Switching Between Two DNA Bound States. Determined by X-ray diffraction at 3.0 Å resolution. Released 14 Jul 2010.
Explore 3L2P in 3D Show helices and sheets RCSB PDB PDBe
3L2P contains 28 α-helices and 25 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 172-174 | 3 | |
| β-strand | 175 | 1 | 1 |
| α-helix | 176-187 | 12 | |
| α-helix | 192-204 | 13 | |
| α-helix | 216-223 | 8 | |
| α-helix | 236-247 | 12 | |
| α-helix | 251-257 | 7 | |
| α-helix | 258-260 | 3 | |
| α-helix | 263-272 | 10 | |
| α-helix | 278-280 | 3 | |
| β-strand | 286 | 1 | 1 |
| α-helix | 287-298 | 12 | |
| α-helix | 303-314 | 12 | |
| α-helix | 320-329 | 10 | |
| α-helix | 339-344 | 6 | |
| α-helix | 350-356 | 7 | |
| α-helix | 360-372 | 13 | |
| β-strand | 398-401 | 4 | 2 |
| α-helix | 405-411 | 7 | |
| β-strand | 416-420 | 5 | 2 |
| β-strand | 425-432 | 8 | 3 |
| β-strand | 435-439 | 5 | 3 |
| α-helix | 444 | 1 | |
| β-strand | 445 | 1 | 3 |
| α-helix | 446-447 | 2 | |
| α-helix | 448-450 | 3 | |
| α-helix | 454-456 | 3 | |
| α-helix | 458-461 | 4 | |
| β-strand | 467-476 | 10 | 3 |
| β-strand | 477 | 1 | 4 |
| β-strand | 484 | 1 | 4 |
| α-helix | 487-490 | 4 | |
| α-helix | 492-497 | 6 | |
| β-strand | 503-513 | 11 | 3 |
| β-strand | 516-517 | 2 | 3 |
| α-helix | 523-533 | 11 | |
| β-strand | 537 | 1 | 3 |
| β-strand | 541-543 | 3 | 3 |
| α-helix | 544-545 | 2 | |
| β-strand | 546-549 | 4 | 2 |
| α-helix | 552-564 | 13 | |
| β-strand | 570-574 | 5 | 2 |
| β-strand | 584-589 | 6 | 2 |
| β-strand | 601-611 | 11 | 5 |
| β-strand | 623-629 | 7 | 5 |
| β-strand | 636-642 | 7 | 5 |
| α-helix | 648-653 | 6 | |
| β-strand | 693-699 | 7 | 5 |
| β-strand | 702-704 | 3 | 6 |
| β-strand | 713-715 | 3 | 6 |
| β-strand | 719-720 | 2 | 5 |
| β-strand | 734 | 1 | 5 |
| α-helix | 735-743 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA ligase 3 | A | protein | 579 | Homo sapiens | P49916 (AlphaFold model) |
| 5'-d(p*cp*gp*gp*gp*ap*tp*gp*cp*gp*tp*c)-3' | B | DNA | 11 | ||
| 5'-d(*gp*tp*cp*gp*gp*ap*cp*tp*g)-3' | C | DNA | 9 | ||
| 5'-d(*gp*cp*cp*ap*gp*tp*cp*cp*gp*ap*cp*gp*ap*cp*gp*cp*ap*tp*cp*cp*cp*g)-3' | D | DNA | 22 |
>3L2P_1 DNA ligase 3 (chains A) HMRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGV IKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTI QEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSGAKHVLDALD PNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASLMTPVQPMLAEACKSVEY AMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAHFKDYIPQAFPGGHS MILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERR KFLHDNMVEIPNRIMFSEMKRVTKALDLADMITRVIQEGLEGLVLKDVKGTYEPGKRHWL KVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGSQKWCTVTKCAGGHD DATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAAVWEITGAEFSKSEA HTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSK
>3L2P_2 5'-D(P*CP*GP*GP*GP*AP*TP*GP*CP*GP*TP*C)-3' (chains B) CGGGATGCGTC
>3L2P_3 5'-D(*GP*TP*CP*GP*GP*AP*CP*TP*G)-3' (chains C) GTCGGACTG
>3L2P_4 5'-D(*GP*CP*CP*AP*GP*TP*CP*CP*GP*AP*CP*GP*AP*CP*GP*CP*AP*TP*CP*CP*CP*G)-3' (chains D) GCCAGTCCGACGACGCATCCCG
| ID | Name | Formula | Copies |
|---|---|---|---|
| AMP | Adenosine monophosphate | C10 H14 N5 O7 P | 1 |
Human DNA Ligase III Recognizes DNA Ends by Dynamic Switching between Two DNA-Bound States. Cotner-Gohara, E., Kim, I.K., Hammel, M. et al. Biochemistry (2010) 49:6165-6176. DOI 10.1021/bi100503w · PubMed
Other PDB entries of the same protein (UniProt P49916 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3L2P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.