Crystal structure of human polymerase alpha-primase p58 iron-sulfur cluster domain. Determined by X-ray diffraction at 1.7 Å resolution. Released 14 Jul 2010.
Explore 3L9Q in 3D Show helices and sheets RCSB PDB PDBe
3L9Q contains 22 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 271-272 | 2 | 1 |
| α-helix | 273-276 | 4 | |
| α-helix | 277-283 | 7 | |
| α-helix | 286-298 | 13 | |
| α-helix | 303-316 | 14 | |
| β-strand | 318-324 | 7 | 1 |
| β-strand | 345-351 | 7 | 1 |
| α-helix | 362-366 | 5 | |
| α-helix | 367-372 | 6 | |
| α-helix | 385-388 | 4 | |
| α-helix | 391-400 | 10 | |
| α-helix | 405-416 | 12 | |
| α-helix | 420-432 | 13 | |
| α-helix | 444-455 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 273-276 | 4 | |
| α-helix | 277-283 | 7 | |
| α-helix | 286-298 | 13 | |
| α-helix | 303-315 | 13 | |
| β-strand | 318-322 | 5 | 2 |
| β-strand | 347-351 | 5 | 2 |
| α-helix | 364-366 | 3 | |
| α-helix | 367-372 | 6 | |
| α-helix | 385-388 | 4 | |
| α-helix | 391-400 | 10 | |
| α-helix | 405-416 | 12 | |
| α-helix | 420-432 | 13 | |
| α-helix | 444-455 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA primase large subunit | A, B | protein | 195 | Homo sapiens | P49643 (AlphaFold model) |
>3L9Q_1 DNA primase large subunit (chains A, B) NSSLDQIDLLSTKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLTLEQALQFWKQ EFIKGKMDPDKFDKGYSYNIRHSFGKEGKRTDYTPFSCLKIILSNPPSQGDYHGCPFRHS DPELLKQKLQSYKISPGGISQILDLVKGTHYQVACQKYFEMIHNVDDCGFSLNHPNQFFC ESQRILNGGKDIKKE
| ID | Name | Formula | Copies |
|---|---|---|---|
| SF4 | Iron/sulfur cluster | Fe4 S4 | 2 |
Water and common crystallization additives (SO4) are not listed.
Insights into eukaryotic DNA priming from the structure and functional interactions of the 4Fe-4S cluster domain of human DNA primase. Vaithiyalingam, S., Warren, E.M., Eichman, B.F. et al. Proc Natl Acad Sci U S A (2010) 107:13684-13689. DOI 10.1073/pnas.1002009107 · PubMed
Other PDB entries of the same protein (UniProt P49643 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3L9Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.