Crystal structure of C-terminal domain of the human DNA primase large subunit with bound DNA template/RNA primer. Determined by X-ray diffraction at 2.21 Å resolution. Released 23 Mar 2016.
Explore 5F0Q in 3D Show helices and sheets RCSB PDB PDBe
5F0Q contains 29 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 273-275 | 3 | |
| α-helix | 276-282 | 7 | |
| α-helix | 286-298 | 13 | |
| α-helix | 303-316 | 14 | |
| α-helix | 320-332 | 13 | |
| α-helix | 338-341 | 4 | |
| α-helix | 342-346 | 5 | |
| α-helix | 347-352 | 6 | |
| β-strand | 353 | 1 | 1 |
| β-strand | 361 | 1 | 1 |
| α-helix | 362-366 | 5 | |
| α-helix | 367-372 | 6 | |
| α-helix | 385-388 | 4 | |
| α-helix | 391-400 | 10 | |
| α-helix | 405-416 | 12 | |
| α-helix | 420-431 | 12 | |
| α-helix | 444-455 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 273-275 | 3 | |
| α-helix | 276-282 | 7 | |
| α-helix | 286-298 | 13 | |
| α-helix | 303-315 | 13 | |
| α-helix | 320-332 | 13 | |
| α-helix | 338-343 | 6 | |
| α-helix | 345-352 | 8 | |
| α-helix | 362-366 | 5 | |
| α-helix | 367-372 | 6 | |
| α-helix | 385-388 | 4 | |
| α-helix | 391-400 | 10 | |
| α-helix | 405-416 | 12 | |
| α-helix | 420-431 | 12 | |
| α-helix | 444-454 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA primase large subunit | A, B | protein | 191 | Homo sapiens | P49643 (AlphaFold model) |
| RNA (5'-r(p*gp*gp*cp*gp*gp*c)-3') | C, E | RNA | 6 | Homo sapiens | |
| DNA (5'-d(*gp*cp*cp*gp*cp*cp*ap*ap*cp*ap*tp*a)-3') | D, F | DNA | 12 | Homo sapiens |
>5F0Q_1 DNA primase large subunit (chains A, B) GNVGKISLDQIDLLSTKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLTLEQALQ FWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEGKRTDYTPFSCLKIILSNPPSQGDYHGCP FRHSDPELLKQKLQSYKISPGGISQILDLVKGTHYQVACQKYFEMIHNVDDCGFSLNHPN QFFCESQRILN
>5F0Q_2 RNA (5'-R(P*GP*GP*CP*GP*GP*C)-3') (chains C, E) GGCGGC
>5F0Q_3 DNA (5'-D(*GP*CP*CP*GP*CP*CP*AP*AP*CP*AP*TP*A)-3') (chains D, F) GCCGCCAACATA
Mechanism of Concerted RNA-DNA Primer Synthesis by the Human Primosome. Baranovskiy, A.G., Babayeva, N.D., Zhang, Y. et al. J Biol Chem (2016) 291:10006-10020. DOI 10.1074/jbc.M116.717405 · PubMed
Other PDB entries of the same protein (UniProt P49643 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5F0Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.