5DQO: DNA primase large subunit

Crystal structure of Y347F mutant of human primase p58 iron-sulfur cluster domain. Determined by X-ray diffraction at 2.3 Å resolution. Released 21 Sept 2016.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,911
Mol. weight: 92.03 kDa
Ligands: SF4
Released: 21 Sept 2016

Explore 5DQO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5DQO contains 43 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	271-272	2	1
α-helix	273-276	4
α-helix	277-283	7
α-helix	286-298	13
α-helix	303-316	14
β-strand	318-321	4	1
β-strand	348-351	4	1
α-helix	364-366	3
α-helix	367-372	6
α-helix	385-388	4
α-helix	391-400	10
α-helix	405-416	12
α-helix	420-432	13
α-helix	444-456	13

Chain B: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	273-276	4
α-helix	277-283	7
α-helix	286-298	13
α-helix	304-314	11
β-strand	319-321	3	2
β-strand	348-350	3	2
α-helix	363-366	4
α-helix	367-370	4
α-helix	385-388	4
α-helix	391-400	10
α-helix	405-416	12
α-helix	420-432	13
α-helix	444-455	12

Chain C: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	273-275	3
α-helix	277-282	6
α-helix	286-298	13
α-helix	303-314	12
β-strand	318-321	4	3
β-strand	348-351	4	3
α-helix	367-370	4
α-helix	385-388	4
α-helix	391-400	10
α-helix	405-416	12
α-helix	420-432	13
α-helix	444-455	12

Chain D: 11 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	273-276	4
α-helix	277-283	7
α-helix	286-297	12
α-helix	303-315	13
β-strand	318-322	5	4
β-strand	325	1	1
β-strand	347-351	5	4
α-helix	364-366	3
α-helix	367-372	6
α-helix	385-388	4
α-helix	391-399	9
α-helix	407-416	10
α-helix	421-432	12
α-helix	444-455	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA primase large subunit	A, B, C, D	protein	197	Homo sapiens	P49643 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5DQO_1 DNA primase large subunit (chains A, B, C, D)
GSPNSLDQIDLLSTKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLTLEQALQFW
KQEFIKGKMDPDKFDKGYSFNIRHSFGKEGKRTDYTPFSCLKIILSNPPSQGDYHGCPFR
HSDPELLKQKLQSYKISPGGISQILDLVKGTHYQVACQKYFEMIHNVDDCGFSLNHPNQF
FCESQRILNGGKDIKKE

Ligands and cofactors

ID	Name	Formula	Copies
SF4	Iron/sulfur cluster	Fe4 S4	4

Primary citation

The [4Fe4S] cluster of human DNA primase functions as a redox switch using DNA charge transport. O'Brien, E., Holt, M.E., Thompson, M.K. et al. Science (2017) 355. DOI 10.1126/science.aag1789 · PubMed

Other PDB entries of the same protein (UniProt P49643 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L9Q 1.7 Å, Crystal structure of human polymerase alpha-primase p58 iron-sulfur cluster domain
5I7M 1.93 Å, Crystal structure of Y345F mutant of human primase p58 iron-sulfur cluster domain
6DHW 2.01 Å, Crystal structure of primase iron-sulfur domain (266-457)
5F0Q 2.21 Å, Crystal structure of C-terminal domain of the human DNA primase large subunit with bound…
3Q36 2.5 Å, Crystal structure of the 4Fe-4S cluster domain of human DNA primase large subunit
4RR2 2.65 Å, Crystal structure of human primase
4BPU 2.7 Å, Crystal structure of human primase in heterodimeric form, comprising PriS and truncated…
8VY3 2.98 Å, Human DNA polymerase alpha/primase - AavLEA1 (1:40 molar ratio)
5F0S 3.0 Å, Crystal structure of C-terminal domain of the human DNA primase large subunit with bound…
4BPW 3.0 Å, Crystal structure of human primase bound to UTP
8QJ7 3.07 Å, Cryo-EM structure of human DNA polymerase alpha-primase in pre-initiation stage 1
8D96 3.35 Å, Human DNA polymerase alpha/primase elongation complex I bound to primer/template

Browse structure collections

About this viewer

MolViewer shows 5DQO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.