Crystal structure of Y347F mutant of human primase p58 iron-sulfur cluster domain. Determined by X-ray diffraction at 2.3 Å resolution. Released 21 Sept 2016.
Explore 5DQO in 3D Show helices and sheets RCSB PDB PDBe
5DQO contains 43 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 271-272 | 2 | 1 |
| α-helix | 273-276 | 4 | |
| α-helix | 277-283 | 7 | |
| α-helix | 286-298 | 13 | |
| α-helix | 303-316 | 14 | |
| β-strand | 318-321 | 4 | 1 |
| β-strand | 348-351 | 4 | 1 |
| α-helix | 364-366 | 3 | |
| α-helix | 367-372 | 6 | |
| α-helix | 385-388 | 4 | |
| α-helix | 391-400 | 10 | |
| α-helix | 405-416 | 12 | |
| α-helix | 420-432 | 13 | |
| α-helix | 444-456 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 273-276 | 4 | |
| α-helix | 277-283 | 7 | |
| α-helix | 286-298 | 13 | |
| α-helix | 304-314 | 11 | |
| β-strand | 319-321 | 3 | 2 |
| β-strand | 348-350 | 3 | 2 |
| α-helix | 363-366 | 4 | |
| α-helix | 367-370 | 4 | |
| α-helix | 385-388 | 4 | |
| α-helix | 391-400 | 10 | |
| α-helix | 405-416 | 12 | |
| α-helix | 420-432 | 13 | |
| α-helix | 444-455 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 273-275 | 3 | |
| α-helix | 277-282 | 6 | |
| α-helix | 286-298 | 13 | |
| α-helix | 303-314 | 12 | |
| β-strand | 318-321 | 4 | 3 |
| β-strand | 348-351 | 4 | 3 |
| α-helix | 367-370 | 4 | |
| α-helix | 385-388 | 4 | |
| α-helix | 391-400 | 10 | |
| α-helix | 405-416 | 12 | |
| α-helix | 420-432 | 13 | |
| α-helix | 444-455 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 273-276 | 4 | |
| α-helix | 277-283 | 7 | |
| α-helix | 286-297 | 12 | |
| α-helix | 303-315 | 13 | |
| β-strand | 318-322 | 5 | 4 |
| β-strand | 325 | 1 | 1 |
| β-strand | 347-351 | 5 | 4 |
| α-helix | 364-366 | 3 | |
| α-helix | 367-372 | 6 | |
| α-helix | 385-388 | 4 | |
| α-helix | 391-399 | 9 | |
| α-helix | 407-416 | 10 | |
| α-helix | 421-432 | 12 | |
| α-helix | 444-455 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA primase large subunit | A, B, C, D | protein | 197 | Homo sapiens | P49643 (AlphaFold model) |
>5DQO_1 DNA primase large subunit (chains A, B, C, D) GSPNSLDQIDLLSTKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLTLEQALQFW KQEFIKGKMDPDKFDKGYSFNIRHSFGKEGKRTDYTPFSCLKIILSNPPSQGDYHGCPFR HSDPELLKQKLQSYKISPGGISQILDLVKGTHYQVACQKYFEMIHNVDDCGFSLNHPNQF FCESQRILNGGKDIKKE
| ID | Name | Formula | Copies |
|---|---|---|---|
| SF4 | Iron/sulfur cluster | Fe4 S4 | 4 |
The [4Fe4S] cluster of human DNA primase functions as a redox switch using DNA charge transport. O'Brien, E., Holt, M.E., Thompson, M.K. et al. Science (2017) 355. DOI 10.1126/science.aag1789 · PubMed
Other PDB entries of the same protein (UniProt P49643 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5DQO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.