3LKX: Human nac dimerization domain

Human nac dimerization domain. Determined by X-ray diffraction at 2.5 Å resolution. Released 23 Mar 2010.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 903
Mol. weight: 13.14 kDa
Released: 23 Mar 2010

Explore 3LKX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LKX contains 3 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	26-27	2	1
β-strand	31-38	8	2
β-strand	42-47	6	2
β-strand	50-54	5	1
β-strand	59-63	5	1
β-strand	66-70	5	2
α-helix	71-74	4
α-helix	77-81	5
α-helix	86-89	4

Chain B: 0 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	27-29	3	1
β-strand	32-39	8	2
β-strand	43-48	6	2
β-strand	51-54	4	1
β-strand	60-64	5	1
β-strand	68-71	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor BTF3	A	protein	66	Homo sapiens	P20290 (AlphaFold model)
Nascent polypeptide-associated complex subunit alpha	B	protein	54	Homo sapiens	Q13765 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3LKX_1 Transcription factor BTF3 (chains A)
VNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGA
DSLTSL

Sequence of entity 2 (B), FASTA

>3LKX_2 Nascent polypeptide-associated complex subunit alpha (chains B)
EGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQ

Primary citation

The crystal structure of the human nascent polypeptide-associated complex domain reveals a nucleic acid-binding region on the NACA subunit. Liu, Y., Hu, Y., Li, X. et al. Biochemistry (2010) 49:2890-2896. DOI 10.1021/bi902050p · PubMed

Other PDB entries of the same protein (UniProt P20290 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MCB 1.9 Å, Crystal structure of NAC domains of human nascent polypeptide-associated complex (NAC)
9I2D 2.19 Å, NMT1-NAC bound human RNC with 10 amino acid ARF1-linker
9PBE 2.19 Å, In situ human 80S ribosome (composite map)
9S3D 2.32 Å, NAC bound human RNC with 58 amino acid ARF1-linker
9S3B 2.38 Å, NMT1-NAC bound human RNC with 58 amino acid ARF1-linker - State 1
9PKD 2.42 Å, In situ CHX and HHT treated 80S consensus ribosome
9S3C 2.42 Å, NMT1-NAC bound human RNC with 58 amino acid ARF1-linker - State 2
9QLO 2.47 Å, NMT1-NAC bound human RNC with full length ARF1 - State 1
9P8B 2.48 Å, In situ human eEF1A-A/T-P-E state 80S ribosome
9P7D 2.57 Å, In situ human Hibernating class4 80S ribosome
9QLQ 2.57 Å, NMT1-NAC bound human RNC with full length ARF1 - alternative State
9P7E 2.59 Å, In situ human Hibernating class5 80S ribosome

Browse structure collections

About this viewer

MolViewer shows 3LKX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.