3LL8: Calcineurin

Crystal Structure of Calcineurin in Complex with AKAP79 Peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Jan 2011.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 5
Atoms: 8,968
Mol. weight: 119.73 kDa
Ligands: CA, FE, ZN, PO4
Released: 12 Jan 2011

Explore 3LL8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LL8 contains 66 α-helices and 49 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	22-25	4
α-helix	27-28	2
β-strand	29	1	2
α-helix	30	1
α-helix	31-34	4
β-strand	35	1	3
β-strand	41	1	3
α-helix	43-51	9
β-strand	56	1	2
α-helix	58-73	16
β-strand	78-81	4	4
α-helix	82	1
β-strand	85-88	4	1
α-helix	95-105	11
β-strand	113-115	3	1
α-helix	126-139	14
β-strand	144-146	3	1
α-helix	154-159	6
α-helix	162-169	8
α-helix	172-183	12
β-strand	188-191	4	4
β-strand	195-197	3	4
α-helix	209-213	5
α-helix	220-222	3
α-helix	226-232	7
β-strand	234-235	2	5
β-strand	248-250	3	5
β-strand	258-260	3	5
α-helix	262-271	10
β-strand	276-279	4	4
β-strand	288-290	3	4
α-helix	292	1
β-strand	293	1	6
α-helix	294	1
β-strand	300	1	6
β-strand	302-305	4	4
α-helix	311-313	3
β-strand	319-325	7	1
β-strand	328-334	7	1
α-helix	344-346	3
α-helix	349-369	21

Chain B: 13 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	17-29	13
β-strand	37	1	7
α-helix	39-42	4
α-helix	46-48	3
α-helix	54-61	8
β-strand	69	1	7
α-helix	71-78	8
α-helix	79-81	3
α-helix	87-98	12
β-strand	106	1	8
α-helix	108-119	12
α-helix	120-122	3
α-helix	125-139	15
β-strand	147	1	8
α-helix	149-156	8
α-helix	157-159	3
α-helix	161-164	4

Chain C: 20 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	27-28	2
β-strand	29	1	9
α-helix	30	1
α-helix	31-34	4
β-strand	35	1	10
β-strand	41	1	10
α-helix	43-51	9
β-strand	56	1	9
α-helix	58-73	16
β-strand	78-81	4	11
α-helix	82	1
β-strand	85-88	4	12
α-helix	95-105	11
β-strand	113-115	3	12
α-helix	126-139	14
β-strand	144-146	3	12
α-helix	154-159	6
α-helix	162-169	8
α-helix	172-184	13
β-strand	188-191	4	11
β-strand	195-198	4	11
α-helix	210-213	4
α-helix	221-222	2
α-helix	226-232	7
β-strand	234-235	2	13
β-strand	248-250	3	13
β-strand	258-260	3	13
α-helix	262-272	11
β-strand	276-279	4	11
β-strand	288-290	3	11
α-helix	292	1
β-strand	293	1	14
α-helix	294	1
β-strand	300	1	14
β-strand	302-305	4	11
α-helix	311-313	3
β-strand	319-325	7	12
β-strand	328-334	7	12
α-helix	344-346	3
α-helix	349-369	21

Chain D: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	16-29	14
β-strand	36-37	2	15
α-helix	39-42	4
α-helix	46-49	4
α-helix	54-61	8
β-strand	69-70	2	15
α-helix	71-79	9
α-helix	87-98	12
β-strand	105-106	2	16
α-helix	108-119	12
α-helix	125-139	15
β-strand	147-148	2	16
α-helix	149-156	8
α-helix	157-159	3
α-helix	161-163	3

Chain E: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	5-6	2
β-strand	7-12	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AKAP79 peptide	E	protein	11	Homo sapiens	P24588 (AlphaFold model)
Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform	A, C	protein	357	Homo sapiens	Q08209 (AlphaFold model)
Calcineurin subunit B type 1	B, D	protein	155	Homo sapiens	P63098 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>3LL8_1 AKAP79 peptide (chains E)
EPIAIIITDTE

Sequence of entity 2 (A, C), FASTA

>3LL8_2 Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (chains A, C)
TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILR
QEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYL
WALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQ
QFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTV
RGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLD
VYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLN

Sequence of entity 3 (B, D), FASTA

>3LL8_3 Calcineurin subunit B type 1 (chains B, D)
DADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEF
IEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDK
TIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	8
FE	FE (III) ion	Fe	2
ZN	Zinc ion	Zn	2
PO4	Phosphate ion	O4 P	2

Primary citation

Balanced interactions of calcineurin with AKAP79 regulate Ca(2+)-calcineurin-NFAT signaling. Li, H., Pink, M.D., Murphy, J.G. et al. Nat Struct Mol Biol (2012) 19:337-345. DOI 10.1038/nsmb.2238 · PubMed

Other PDB entries of the same protein (UniProt P24588 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NIN 1.7 Å, Crystal Structure of AKAP79 calmodulin binding domain peptide in complex with…
2H9R Docking and dimerization domain (D/D) of the regulatory subunit of the Type II-alpha…

Browse structure collections

About this viewer

MolViewer shows 3LL8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.