3LUI: SNX17 PX domain with bound sulphate

Crystal structure of the SNX17 PX domain with bound sulphate. Determined by X-ray diffraction at 1.8 Å resolution. Released 2 Mar 2010.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,144
Mol. weight: 39.82 kDa
Released: 2 Mar 2010

Explore 3LUI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LUI contains 18 α-helices and 9 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	3-11	9	1
β-strand	20-27	8	1
β-strand	30-36	7	1
α-helix	37-51	15
α-helix	57-62	6
α-helix	66-68	3
α-helix	69-88	20
α-helix	90-94	5
α-helix	96-109	14

Chain B: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	3-10	8	2
β-strand	21-27	7	2
β-strand	30-36	7	2
α-helix	37-51	15
α-helix	53-55	3
α-helix	57-62	6
α-helix	66-68	3
α-helix	69-88	20
α-helix	96-110	15

Chain C: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	3-11	9	3
β-strand	20-27	8	3
β-strand	30-35	6	3
α-helix	37-51	15
α-helix	57-62	6
α-helix	66-68	3
α-helix	69-88	20
α-helix	90-93	4
α-helix	96-108	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-17	A, B, C	protein	115	Homo sapiens	Q15036 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3LUI_1 Sorting nexin-17 (chains A, B, C)
SNAMHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLP
AFPPKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQV

Primary citation

Phox homology band 4.1/ezrin/radixin/moesin-like proteins function as molecular scaffolds that interact with cargo receptors and Ras GTPases. Ghai, R., Mobli, M., Norwood, S.J. et al. Proc Natl Acad Sci U S A (2011). DOI 10.1073/pnas.1017110108 · PubMed

Other PDB entries of the same protein (UniProt Q15036 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GXB 1.8 Å, Structure of the SNX17 atypical FERM domain bound to the NPxY motif of P-selectin
3FOG 2.8 Å, Crystal structure of the PX domain of sorting nexin-17 (SNX17)
4TKN 3.0 Å, Structure of the SNX17 FERM domain bound to the second NPxF motif of KRIT1
9AU7 3.4 Å, Human Retriever VPS35L/VPS29/VPS26C complex bound to SNX17 peptide (Composite Map)
7RM8 Solution NMR structure of PDLIM7 PDZ bound to SNX17 peptide

Browse structure collections

About this viewer

MolViewer shows 3LUI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.