3M1D: BIR1 from cIAP1

Structure of BIR1 from cIAP1. Determined by X-ray diffraction at 2.0 Å resolution. Released 26 May 2010.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,335
Mol. weight: 19.13 kDa
Ligands: ZN
Released: 26 May 2010

Explore 3M1D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3M1D contains 10 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	43-51	9
α-helix	52-55	4
α-helix	64-69	6
β-strand	72-74	3	1
β-strand	81-83	3	1
β-strand	89-90	2	1
α-helix	99-106	8
α-helix	111-117	7

Chain B: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	43-51	9
α-helix	52-55	4
α-helix	64-69	6
β-strand	72-74	3	2
β-strand	81-83	3	2
β-strand	89-90	2	2
α-helix	99-106	8
α-helix	111-116	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 2	A, B	protein	85	Homo sapiens	Q13490 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3M1D_1 Baculoviral IAP repeat-containing protein 2 (chains A, B)
GPLGSKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWK
LGDSPIQKHKQLYPSCSFIQNLVSA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Asymmetric recruitment of cIAPs by TRAF2. Mace, P.D., Smits, C., Vaux, D.L. et al. J Mol Biol (2010) 400:8-15. DOI 10.1016/j.jmb.2010.04.055 · PubMed

Other PDB entries of the same protein (UniProt Q13490 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HY4 1.25 Å, Crystal structure of cIAP1 BIR3 bound to T3170284
7QGJ 1.3 Å, Apo structure of BIR2 Domain of BIRC2
3D9T 1.5 Å, CIAP1-BIR3 in complex with N-terminal peptide from Caspase-9 (ATPFQE)
8DSF 1.5 Å, Structure of cIAP1 with BCCov
4KMN 1.52 Å, Structure of cIAP1-BIR3 and inhibitor
4LGE 1.55 Å, Crystal structure of clAP1 BIR3 bound to T3261256
6HPR 1.7 Å, Crystal structure of cIAP1 RING domain bound to UbcH5B-Ub and a non-covalent Ub
7TRL 1.74 Å, Crystal structure of human BIRC2 BIR3 domain in complex with histone H3
4HY5 1.75 Å, Crystal structure of cIAP1 BIR3 bound to T3256336
3UW4 1.79 Å, Crystal structure of cIAP1 BIR3 bound to GDC0152
4MU7 1.79 Å, Crystal structure of cIAP1 BIR3 bound to T3450325
5M6N 1.8 Å, Small Molecule inhibitors of IAP

Browse structure collections

About this viewer

MolViewer shows 3M1D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.