3M1O: Human Transthyretin

Human Transthyretin (TTR) complexed with 2-((3,5-dichloro-4-hydroxyphenyl)amino)benzoic acid. Determined by X-ray diffraction at 1.2 Å resolution. Released 17 Nov 2010.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,233
Mol. weight: 28.15 kDa
Ligands: CJZ
Released: 17 Nov 2010

Explore 3M1O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3M1O contains 2 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
β-strand	23-24	2	1
β-strand	29-35	7	2
β-strand	41-48	8	2
β-strand	54-55	2	1
β-strand	67-73	7	2
α-helix	75-81	7
β-strand	88-97	10	2
β-strand	99	1	3
β-strand	101	1	3
β-strand	104-112	9	1
β-strand	115-123	9	1

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
β-strand	23-24	2	1
β-strand	29-35	7	2
β-strand	41-48	8	2
β-strand	54-55	2	1
β-strand	67-73	7	2
α-helix	75-81	7
β-strand	88-97	10	2
β-strand	105-112	8	1
β-strand	115-122	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transthyretin	A, B	protein	127	Homo sapiens	P02766 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3M1O_1 Transthyretin (chains A, B)
GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTT
EEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTA
VVTNPKE

Ligands and cofactors

ID	Name	Formula	Copies
CJZ	2-[(3,5-dichloro-4-hydroxyphenyl)amino]benzoic acid	C13 H9 Cl2 N O3	2

Primary citation

Trapping of palindromic ligands within native transthyretin prevents amyloid formation. Kolstoe, S.E., Mangione, P.P., Bellotti, V. et al. Proc Natl Acad Sci U S A (2010) 107:20483-20488. DOI 10.1073/pnas.1008255107 · PubMed

Other PDB entries of the same protein (UniProt P02766 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F86 1.1 Å, Transthyretin THR119MET protein stabilisation
8C86 1.1 Å, Crystal structure of human transthyretin in complex with 3-O-methyltolcapone analogue 2
8W45 1.1 Å, X-ray crystal structure of V30M-TTR in complex with pinostilbene
4QXV 1.12 Å, Crystal structure of human transthyretin in complex with luteolin at 1.1 a resolution
4KY2 1.13 Å, Transthyretin in complex with the fluorescent folding sensor…
4D7B 1.15 Å, Structure of human transthyretin in complex with Tolcapone
7EJQ 1.15 Å, Crystal structure of human transthyretin in complex with…
8AWI 1.15 Å, Crystal structure of Human Transthyretin at 1.15 Angstrom resolution
6TXW 1.15 Å, V30G Transthyretin structure in complex with Tolcalpone
4L1T 1.16 Å, Transthyretin in complex with (E)-3-(dimethylamino)-5-(4-hydroxy-3,5-dimethylstyryl)benzo…
4HIQ 1.18 Å, The Structure of V122I Mutant Transthyretin in Complex with AG10
9H7L 1.18 Å, Human Transthyretin in Complex with 4-phenyl-1H-pyrazolo[3,4-b]pyridin-3-amine

Browse structure collections

About this viewer

MolViewer shows 3M1O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.