Crystal Structure of the 25kDa Subunit of Human Cleavage factor Im in complex with RNA UUGUAU. Determined by X-ray diffraction at 2.22 Å resolution. Released 2 Jun 2010.
Explore 3MDG in 3D Show helices and sheets RCSB PDB PDBe
3MDG contains 15 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-39 | 4 | 1 |
| β-strand | 41 | 1 | 2 |
| α-helix | 42-44 | 3 | |
| β-strand | 45-50 | 6 | 3 |
| α-helix | 60-74 | 15 | |
| β-strand | 77-84 | 8 | 4 |
| β-strand | 85-87 | 3 | 2 |
| β-strand | 92-98 | 7 | 2 |
| β-strand | 104-105 | 2 | 2 |
| β-strand | 108-110 | 3 | 4 |
| α-helix | 111-112 | 2 | |
| α-helix | 117-129 | 13 | |
| β-strand | 130 | 1 | 3 |
| β-strand | 140-150 | 11 | 4 |
| β-strand | 158 | 1 | 4 |
| β-strand | 170-178 | 9 | 4 |
| β-strand | 183-188 | 6 | 3 |
| β-strand | 192-197 | 6 | 2 |
| α-helix | 198-201 | 4 | |
| α-helix | 205-212 | 8 | |
| α-helix | 215-219 | 5 | |
| β-strand | 223-226 | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-39 | 4 | 5 |
| β-strand | 41 | 1 | 6 |
| α-helix | 42-44 | 3 | |
| β-strand | 45-50 | 6 | 7 |
| α-helix | 60-74 | 15 | |
| β-strand | 77-84 | 8 | 8 |
| β-strand | 85-88 | 4 | 6 |
| β-strand | 91-98 | 8 | 6 |
| β-strand | 104-105 | 2 | 6 |
| β-strand | 108-110 | 3 | 8 |
| α-helix | 111-112 | 2 | |
| α-helix | 117-129 | 13 | |
| β-strand | 130 | 1 | 7 |
| β-strand | 140-150 | 11 | 8 |
| β-strand | 158 | 1 | 8 |
| β-strand | 170-178 | 9 | 8 |
| α-helix | 179-180 | 2 | |
| β-strand | 183-188 | 6 | 7 |
| β-strand | 192-197 | 6 | 6 |
| α-helix | 198-201 | 4 | |
| α-helix | 205-212 | 8 | |
| α-helix | 215-219 | 5 | |
| β-strand | 223-226 | 4 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cleavage and polyadenylation specificity factor subunit 5 | A, B | protein | 227 | Homo sapiens | O43809 (AlphaFold model) |
| RNA (5'-r(*up*up*gp*up*ap*u)-3') | C | RNA | 6 |
>3MDG_1 Cleavage and polyadenylation specificity factor subunit 5 (chains A, B) MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV AARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEG LKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQ EKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
>3MDG_2 RNA (5'-R(*UP*UP*GP*UP*AP*U)-3') (chains C) UUGUAU
Structural basis of UGUA recognition by the Nudix protein CFI(m)25 and implications for a regulatory role in mRNA 3' processing. Yang, Q., Gilmartin, G.M., Doublie, S. Proc Natl Acad Sci U S A (2010) 107:10062-10067. DOI 10.1073/pnas.1000848107 · PubMed
Other PDB entries of the same protein (UniProt O43809 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3MDG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.