3MFS: CASK-4M CaM Kinase Domain, AMPPNP

CASK-4M CaM Kinase Domain, AMPPNP. Determined by X-ray diffraction at 2.1 Å resolution. Released 28 Apr 2010.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,676
Mol. weight: 39.8 kDa
Ligands: ANP
Released: 28 Apr 2010

Explore 3MFS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MFS contains 18 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	12-20	9	1
β-strand	24-31	8	1
β-strand	37-44	8	1
α-helix	45-49	5
α-helix	56-68	13
β-strand	74	1	2
β-strand	77-82	6	1
β-strand	86-92	7	1
β-strand	98	1	2
α-helix	99-108	10
α-helix	115-134	20
β-strand	137-138	2	3
α-helix	144-146	3
β-strand	147-149	3	2
α-helix	156-157	2
β-strand	158-160	3	2
β-strand	167-168	2	3
β-strand	175	1	4
α-helix	183-185	3
α-helix	188-191	4
β-strand	196	1	4
α-helix	199-214	16
α-helix	223-232	10
α-helix	239-242	4
α-helix	247-256	10
α-helix	265-266	2
α-helix	267-271	5
α-helix	274-277	4
α-helix	279-282	4
α-helix	289-304	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peripheral plasma membrane protein CASK	A	protein	351	Homo sapiens	O14936 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3MFS_1 Peripheral plasma membrane protein CASK (chains A)
GSPGISGGGGGILDMADDDVLFEDVYELCEVIGKGAFSVVRRCINRETGQQFAVKIVDVA
KFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKR
ADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPENVLLASKENSAPVKLGDFGVA
IQLGESGLVAGGRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERL
FEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKI
HLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTS

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1

Primary citation

Evolution of CASK into a Mg2+-sensitive kinase. Mukherjee, K., Sharma, M., Jahn, R. et al. Sci Signal (2010) 3:ra33-ra33. DOI 10.1126/scisignal.2000800 · PubMed

Other PDB entries of the same protein (UniProt O14936 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KGD 1.31 Å, Crystal Structure of the Guanylate Kinase-like Domain of Human CASK
9M6G 1.7 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK-Mint1-CID complex
9KYS 1.76 Å, the Ca2+/CaM-CASK-ARD complex
9M5Y 1.8 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK complex
3C0I 1.85 Å, CASK CaM-Kinase Domain- 3'-AMP complex, P212121 form
6NH9 1.85 Å, Crystal structure of a human calcium/calmodulin dependent serine protein kinase (CASK)…
6NID 1.86 Å, Crystal structure of a human calcium/calmodulin dependent serine protein kinase (CASK)…
1KWA 1.93 Å, Human cask/lin-2 PDZ domain
7OAJ 1.93 Å, Crystal structure of pseudokinase CASK in complex with compound 7
3MFR 2.0 Å, CASK-4M CaM Kinase Domain, native
7OAL 2.17 Å, Crystal structure of pseudokinase CASK in complex with compound 25
3C0G 2.19 Å, CASK CaM-Kinase Domain- 3'-AMP complex, P1 form

Browse structure collections

About this viewer

MolViewer shows 3MFS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.