PWWP Domain of Human Bromodomain and PHD finger-containing protein 1 In Complex with Trimethylated H3K36 Peptide. Determined by X-ray diffraction at 1.69 Å resolution. Released 2 Jun 2010.
Explore 3MO8 in 3D Show helices and sheets RCSB PDB PDBe
3MO8 contains 5 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1088-1091 | 4 | 1 |
| β-strand | 1099-1104 | 6 | 1 |
| β-strand | 1113-1115 | 3 | 2 |
| β-strand | 1118-1120 | 3 | 2 |
| α-helix | 1121-1124 | 4 | |
| α-helix | 1125-1137 | 13 | |
| β-strand | 1143-1147 | 5 | 1 |
| β-strand | 1154-1157 | 4 | 1 |
| α-helix | 1159-1161 | 3 | |
| β-strand | 1162-1164 | 3 | 1 |
| α-helix | 1169-1176 | 8 | |
| α-helix | 1182-1203 | 22 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peregrin | A | protein | 130 | Homo sapiens | P55201 (AlphaFold model) |
| Histone H3.2 TRIMETHYLATED H3K36 PEPTIDE | B | protein | 12 | Homo sapiens | Q16695 (AlphaFold model) |
>3MO8_1 Peregrin (chains A) GEDSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQE AREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQ HRSKVQGEQS
>3MO8_2 Histone H3.2 TRIMETHYLATED H3K36 PEPTIDE (chains B) PATGGVKKPHRY
Structural and Histone Binding Ability Characterizations of Human PWWP Domains. Wu, H., Zeng, H., Lam, R. et al. PLoS One (2011) 6:e18919-e18919. DOI 10.1371/journal.pone.0018919 · PubMed
Other PDB entries of the same protein (UniProt P55201 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3MO8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.