3MTU: PDB entry 3MTU

Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle. Determined by X-ray diffraction at 2.1 Å resolution. Released 23 Jun 2010.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Gallus gallus, Homo sapiens, Bacillus phage phi29
Chains: 6
Atoms: 3,767
Mol. weight: 53.72 kDa
Ligands: EOH
Released: 23 Jun 2010

Explore 3MTU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MTU contains 16 α-helices and 2 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	-1-230	47
α-helix	232-234	3
α-helix	237-247	11
β-strand	249	1	1
β-strand	252	1	1

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	-1-230	47
α-helix	232-234	3
α-helix	237-246	10

Chains C and D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	1-230	45
α-helix	232-234	3
α-helix	237-246	10

Chain E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-14	9
α-helix	23-283	51

Chain F: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-14	9
α-helix	23-282	50

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1	A, B, C, D	protein	75	Gallus gallus, Homo sapiens	P04268 (AlphaFold model), Q15691 (AlphaFold model)
Capsid assembly scaffolding protein,Tropomyosin alpha-1 chain	E, F	protein	77	Bacillus phage phi29, Gallus gallus	P04268 (AlphaFold model), P13848

Sequence of entity 1 (A, B, C, D), FASTA

>3MTU_1 Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1 (chains A, B, C, D)
GASMDAIKKKMQMLKLDKENALDRAEQAEADKDFYFGKLRNIELICQENEGENDPVLQRI
VDILYATDEGFVIPD

Sequence of entity 2 (E, F), FASTA

>3MTU_2 Capsid assembly scaffolding protein,Tropomyosin alpha-1 chain (chains E, F)
GGSGPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLEEKVAHAKEEN
LNMHQMLDQTLLELNNM

Ligands and cofactors

ID	Name	Formula	Copies
EOH	Ethanol	C2 H6 O	7

Water and common crystallization additives (EDO, CL) are not listed.

Primary citation

Structure of the tropomyosin overlap complex from chicken smooth muscle: insight into the diversity of N-terminal recognition . Frye, J., Klenchin, V.A., Rayment, I. Biochemistry (2010) 49:4908-4920. DOI 10.1021/bi100349a · PubMed

Other PDB entries of the same protein (UniProt P04268 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U1C 1.8 Å, Anti-parallel dimer of N-terminal 98-aa fragment of smooth muscle tropomyosin alpha
1IC2 2.0 Å, Deciphering the design of the tropomyosin molecule
3U1A 2.0 Å, N-terminal 81-aa fragment of smooth muscle tropomyosin alpha
3MUD 2.2 Å, Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle

Browse structure collections

About this viewer

MolViewer shows 3MTU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.