The catalytic domain of USP8 in complex with a USP8 specific inhibitor. Determined by X-ray diffraction at 2.6 Å resolution. Released 23 Jun 2010.
Explore 3N3K in 3D Show helices and sheets RCSB PDB PDBe
3N3K contains 21 α-helices and 35 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 759-765 | 7 | |
| α-helix | 767 | 1 | |
| β-strand | 768-769 | 2 | 1 |
| β-strand | 778-779 | 2 | 1 |
| α-helix | 786-796 | 11 | |
| α-helix | 801-806 | 6 | |
| α-helix | 809-812 | 4 | |
| α-helix | 825-839 | 15 | |
| β-strand | 842-845 | 4 | 1 |
| α-helix | 848-857 | 10 | |
| β-strand | 858 | 1 | 2 |
| α-helix | 859-861 | 3 | |
| α-helix | 869-883 | 15 | |
| α-helix | 903-917 | 15 | |
| α-helix | 921-926 | 6 | |
| β-strand | 928-936 | 9 | 3 |
| β-strand | 942-945 | 4 | 3 |
| β-strand | 948-949 | 2 | 3 |
| β-strand | 952-954 | 3 | 4 |
| α-helix | 955-956 | 2 | |
| β-strand | 961-963 | 3 | 5 |
| α-helix | 964-971 | 8 | |
| β-strand | 975-977 | 3 | 3 |
| α-helix | 979-981 | 3 | |
| α-helix | 982 | 1 | |
| β-strand | 983-985 | 3 | 6 |
| β-strand | 990-992 | 3 | 6 |
| β-strand | 994-1002 | 9 | 3 |
| β-strand | 1006-1011 | 6 | 4 |
| β-strand | 1014-1016 | 3 | 7 |
| β-strand | 1021-1023 | 3 | 7 |
| β-strand | 1027-1029 | 3 | 5 |
| β-strand | 1035 | 1 | 8 |
| α-helix | 1038-1040 | 3 | |
| β-strand | 1041 | 1 | 3 |
| β-strand | 1051 | 1 | 8 |
| β-strand | 1052-1060 | 9 | 4 |
| β-strand | 1067-1074 | 8 | 4 |
| β-strand | 1079-1084 | 6 | 4 |
| β-strand | 1087-1090 | 4 | 4 |
| α-helix | 1093-1095 | 3 | |
| β-strand | 1101-1107 | 7 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 9 |
| α-helix | 8-10 | 3 | |
| β-strand | 11-16 | 6 | 9 |
| β-strand | 22 | 1 | 10 |
| α-helix | 23-34 | 12 | |
| α-helix | 38-40 | 3 | |
| β-strand | 41-45 | 5 | 9 |
| β-strand | 47 | 1 | 2 |
| β-strand | 48-49 | 2 | 9 |
| α-helix | 50-51 | 2 | |
| β-strand | 52 | 1 | 11 |
| β-strand | 54 | 1 | 11 |
| β-strand | 55 | 1 | 10 |
| β-strand | 66-71 | 6 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin carboxyl-terminal hydrolase 8 | A | protein | 396 | Homo sapiens | P40818 (AlphaFold model) |
| Ubiquitin | B | protein | 85 | Homo sapiens | P0CG48 (AlphaFold model) |
>3N3K_1 Ubiquitin carboxyl-terminal hydrolase 8 (chains A) MGSSHHHHHHSSGLVPRGSPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGP ALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIM KALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYK EENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSL PLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRF SYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKN AARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG
>3N3K_2 Ubiquitin (chains B) GSHMRIVVKTLMGRTIILEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS DYNIHNHSALYLLLKLRGGGGGGSG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
A strategy for modulation of enzymes in the ubiquitin system. Ernst, A., Avvakumov, G., Tong, J. et al. Science (2013) 339:590-595. DOI 10.1126/science.1230161 · PubMed
Other PDB entries of the same protein (UniProt P40818 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3N3K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.