Structure of Csm1 full-length. Determined by X-ray diffraction at 3.41 Å resolution. Released 1 Sept 2010.
Explore 3N4X in 3D Show helices and sheets RCSB PDB PDBe
3N4X contains 20 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 18-82 | 65 | |
| β-strand | 84-86 | 3 | 1 |
| β-strand | 90-91 | 2 | 1 |
| β-strand | 96-102 | 7 | 1 |
| β-strand | 116-122 | 7 | 1 |
| β-strand | 132-134 | 3 | 1 |
| β-strand | 136 | 1 | 1 |
| α-helix | 143-152 | 10 | |
| α-helix | 155-158 | 4 | |
| β-strand | 161-163 | 3 | 1 |
| α-helix | 165-167 | 3 | |
| α-helix | 168-178 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 20-82 | 63 | |
| β-strand | 85-86 | 2 | 2 |
| β-strand | 90-91 | 2 | 2 |
| β-strand | 96-101 | 6 | 2 |
| β-strand | 117-122 | 6 | 2 |
| β-strand | 132-134 | 3 | 2 |
| β-strand | 136 | 1 | 2 |
| α-helix | 143-152 | 10 | |
| α-helix | 155-158 | 4 | |
| β-strand | 161-163 | 3 | 2 |
| α-helix | 165-167 | 3 | |
| α-helix | 168-178 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 17-82 | 66 | |
| β-strand | 84-86 | 3 | 3 |
| β-strand | 90-91 | 2 | 3 |
| β-strand | 96-103 | 8 | 3 |
| β-strand | 115-123 | 9 | 3 |
| β-strand | 131-134 | 4 | 3 |
| β-strand | 136 | 1 | 3 |
| α-helix | 143-152 | 10 | |
| α-helix | 155-158 | 4 | |
| β-strand | 161-163 | 3 | 3 |
| α-helix | 165-167 | 3 | |
| α-helix | 168-178 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-82 | 79 | |
| β-strand | 84-86 | 3 | 4 |
| β-strand | 90-91 | 2 | 4 |
| β-strand | 96-102 | 7 | 4 |
| β-strand | 117-122 | 6 | 4 |
| β-strand | 132-134 | 3 | 4 |
| β-strand | 136 | 1 | 4 |
| α-helix | 143-152 | 10 | |
| α-helix | 155-158 | 4 | |
| β-strand | 161-163 | 3 | 4 |
| α-helix | 165-167 | 3 | |
| α-helix | 168-178 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Monopolin complex subunit CSM1 | A, B, C, D | protein | 190 | Saccharomyces cerevisiae | P25651 (AlphaFold model) |
>3N4X_1 Monopolin complex subunit CSM1 (chains A, B, C, D) MDPLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKEL KTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSGGSSDDYSIMDYKL GFVKGQAQVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSLN KKREKKDETE
The Monopolin Complex Crosslinks Kinetochore Components to Regulate Chromosome-Microtubule Attachments. Corbett, K.D., Yip, C.K., Ee, L.S. et al. Cell (2010) 142:556-567. DOI 10.1016/j.cell.2010.07.017 · PubMed
Other PDB entries of the same protein (UniProt P25651 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3N4X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.