5KTB: Complex between S. cerevisiae Csm1 and Mam1

Structure of a complex between S. cerevisiae Csm1 and Mam1. Determined by X-ray diffraction at 3.05 Å resolution. Released 20 Jul 2016.

Method: X-ray diffraction
Resolution: 3.05 Å
Organism: Saccharomyces cerevisiae
Chains: 3
Atoms: 2,834
Mol. weight: 51.6 kDa
Released: 20 Jul 2016

Explore 5KTB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5KTB contains 14 α-helices and 10 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	21-82	62
β-strand	84-91	8	1
β-strand	96-103	8	1
β-strand	115-122	8	1
β-strand	131-136	6	1
α-helix	143-152	10
α-helix	155-158	4
β-strand	161-164	4	1
α-helix	166-179	14

Chain B: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	17-82	66
β-strand	84-91	8	2
β-strand	95-103	9	2
β-strand	115-123	9	2
β-strand	132-136	5	2
α-helix	143-152	10
α-helix	155-158	4
β-strand	161-163	3	2
α-helix	165-167	3
α-helix	168-180	13

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	227-229	3
α-helix	231-233	3
α-helix	234-237	4
α-helix	240-242	3
α-helix	247-253	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Monopolin complex subunit CSM1	A, B	protein	190	Saccharomyces cerevisiae	P25651 (AlphaFold model)
Monopolin complex subunit MAM1	C	protein	70	Saccharomyces cerevisiae	P40065 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5KTB_1 Monopolin complex subunit CSM1 (chains A, B)
MDPLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKEL
KTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSGGSSDDYSIMDYKL
GFVKGQAQVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSLN
KKREKKDETE

Sequence of entity 2 (C), FASTA

>5KTB_2 Monopolin complex subunit MAM1 (chains C)
QKKRFLPQSVLIKREDEIAFDDFHLDARKVLNDLSATSENPFSSSPNTKKIKSKGKTLEV
VPKKKNKKII

Primary citation

Molecular architecture of the yeast monopolin complex. Corbett, K.D., Harrison, S.C. Cell Rep (2012) 1:583-589. DOI 10.1016/j.celrep.2012.05.012 · PubMed

Other PDB entries of the same protein (UniProt P25651 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5V3N 1.3 Å, Structure of S. cerevisiae Ulp2-Tof2-Csm1 complex
6DEI 1.7 Å, Structure of Dse3-Csm1 complex
5V1A 2.14 Å, Structure of S. cerevisiae Ulp2:Csm1 complex
3N4S 2.35 Å, Structure of Csm1 C-terminal domain, P21212 form
3N4R 2.6 Å, Structure of Csm1 C-terminal domain, R3 form
3N4X 3.41 Å, Structure of Csm1 full-length
3N7N 3.9 Å, Structure of Csm1/Lrs4 complex

Browse structure collections

About this viewer

MolViewer shows 5KTB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.