3N7P: Calcitonin gene-related peptide type 1 receptor

Crystal structure of the ectodomain complex of the CGRP receptor, a Class-B GPCR, reveals the site of drug antagonism. Determined by X-ray diffraction at 2.8 Å resolution. Released 15 Sept 2010.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 8
Atoms: 5,529
Mol. weight: 99.84 kDa
Released: 15 Sept 2010

Explore 3N7P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3N7P contains 37 α-helices and 39 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	36-52	17
β-strand	64-65	2	1
α-helix	66-67	2
β-strand	68-69	2	2
β-strand	74-75	2	2
β-strand	78-79	2	1
β-strand	82-87	6	3
α-helix	88-89	2
β-strand	100-105	6	3
β-strand	111	1	3
β-strand	113	1	4
β-strand	120	1	4
β-strand	123	1	3

Chain B: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	36-54	19
β-strand	64-65	2	5
α-helix	66-67	2
β-strand	68-69	2	6
β-strand	74-75	2	6
β-strand	78-79	2	5
β-strand	82-87	6	7
β-strand	100-105	6	7
β-strand	111	1	7
β-strand	113	1	8
β-strand	120	1	8
β-strand	123	1	7

Chain C: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	38-53	16
β-strand	69	1	9
β-strand	74	1	9
β-strand	84-85	2	10
α-helix	87-89	3
β-strand	102-103	2	10
β-strand	105	1	11
β-strand	111	1	11
α-helix	112	1
β-strand	113	1	12
β-strand	120	1	12
β-strand	123	1	10

Chain D: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	29-35	7
α-helix	36-41	6
α-helix	42-51	10
α-helix	53-55	3
α-helix	59-80	22
α-helix	87-100	14
α-helix	113-115	3

Chain E: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	32-35	4
α-helix	36-41	6
α-helix	42-51	10
α-helix	53-55	3
α-helix	59-80	22
α-helix	87-100	14

Chain F: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	29-39	11
α-helix	41-51	11
α-helix	53-55	3
α-helix	59-80	22
α-helix	87-100	14

Chain J: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	34-54	21
β-strand	64-65	2	13
α-helix	66-67	2
β-strand	68-69	2	14
β-strand	74-75	2	14
β-strand	78-79	2	13
β-strand	82-87	6	15
α-helix	88-89	2
β-strand	100-105	6	15
β-strand	111	1	15
β-strand	113	1	16
β-strand	120	1	16
β-strand	123	1	15
α-helix	125-127	3

Chain R: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	29-35	7
α-helix	36-41	6
α-helix	42-51	10
α-helix	53-55	3
α-helix	59-80	22
α-helix	87-100	14
α-helix	113-114	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcitonin gene-related peptide type 1 receptor	A, B, C, J	protein	115	Homo sapiens	Q16602 (AlphaFold model)
Receptor activity-modifying protein 1	D, E, F, R	protein	96	Homo sapiens	O60894 (AlphaFold model)

Sequence of entity 1 (A, B, C, J), FASTA

>3N7P_1 Calcitonin gene-related peptide type 1 receptor (chains A, B, C, J)
GSHMELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDV
AAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHE

Sequence of entity 2 (D, E, F, R), FASTA

>3N7P_2 Receptor activity-modifying protein 1 (chains D, E, F, R)
GSHMACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLG
CFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS

Primary citation

Crystal Structure of the Ectodomain Complex of the CGRP Receptor, a Class-B GPCR, Reveals the Site of Drug Antagonism. Ter Haar, E., Koth, C.M., Abdul-Manan, N. et al. Structure (2010) 18:1083-1093. DOI 10.1016/j.str.2010.05.014 · PubMed

Other PDB entries of the same protein (UniProt Q16602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZHO 1.6 Å, Crystal structure of a CGRP receptor ectodomain heterodimer with bound high affinity…
8AX7 1.65 Å, Crystal structure of a CGRP receptor ectodomain heterodimer bound to macrocyclic…
4RWF 1.76 Å, Crystal structure of the CLR:RAMP2 extracellular domain heterodimer with bound…
6V2E 1.83 Å, Crystal structure of the human CLR:RAMP2 extracellular domain heterodimer with bound…
7P0F 1.85 Å, Crystal structure of a CGRP receptor ectodomain heterodimer bound to macrocyclic…
8AX6 1.9 Å, Crystal structure of a CGRP receptor ectodomain heterodimer bound to macrocyclic…
6D1U 2.05 Å, Crystal structure of the human CLR:RAMP1 extracellular domain heterodimer in complex…
3N7S 2.1 Å, Crystal structure of the ectodomain complex of the CGRP receptor, a Class-B GPCR,…
6UVA 2.3 Å, CryoEM Structure of the active Adrenomedullin 2 receptor G protein complex with…
7P0I 2.3 Å, Crystal structure of a CGRP receptor ectodomain heterodimer bound to macrocyclic…
6UUS 2.4 Å, CryoEM Structure of the active Adrenomedullin 2 receptor G protein complex with…
4RWG 2.44 Å, Crystal structure of the CLR:RAMP1 extracellular domain heterodimer with bound high…

Browse structure collections

About this viewer

MolViewer shows 3N7P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.