Crystal structure of the ectodomain complex of the CGRP receptor, a Class-B GPCR, reveals the site of drug antagonism. Determined by X-ray diffraction at 2.9 Å resolution. Released 15 Sept 2010.
Explore 3N7R in 3D Show helices and sheets RCSB PDB PDBe
3N7R contains 21 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 33-52 | 20 | |
| β-strand | 64-65 | 2 | 1 |
| α-helix | 66-67 | 2 | |
| β-strand | 68-69 | 2 | 2 |
| β-strand | 74-75 | 2 | 2 |
| β-strand | 78-79 | 2 | 1 |
| β-strand | 83-87 | 5 | 3 |
| α-helix | 88-89 | 2 | |
| β-strand | 100-104 | 5 | 3 |
| β-strand | 105 | 1 | 4 |
| α-helix | 106 | 1 | |
| β-strand | 111 | 1 | 4 |
| β-strand | 113 | 1 | 5 |
| β-strand | 120 | 1 | 5 |
| β-strand | 123 | 1 | 3 |
| α-helix | 125-127 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 35-53 | 19 | |
| β-strand | 64-65 | 2 | 6 |
| α-helix | 66-67 | 2 | |
| β-strand | 68-69 | 2 | 7 |
| β-strand | 74-75 | 2 | 7 |
| β-strand | 78-79 | 2 | 6 |
| β-strand | 83-87 | 5 | 8 |
| α-helix | 88-89 | 2 | |
| β-strand | 100-104 | 5 | 8 |
| β-strand | 105 | 1 | 9 |
| β-strand | 111 | 1 | 9 |
| β-strand | 113 | 1 | 10 |
| β-strand | 120 | 1 | 10 |
| β-strand | 123 | 1 | 8 |
| α-helix | 125-127 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 29-35 | 7 | |
| α-helix | 36-40 | 5 | |
| α-helix | 41-51 | 11 | |
| α-helix | 53-55 | 3 | |
| α-helix | 59-80 | 22 | |
| α-helix | 87-100 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calcitonin gene-related peptide type 1 receptor | A, B | protein | 115 | Homo sapiens | Q16602 (AlphaFold model) |
| Receptor activity-modifying protein 1 | C, D | protein | 96 | Homo sapiens | O60894 (AlphaFold model) |
>3N7R_1 Calcitonin gene-related peptide type 1 receptor (chains A, B) GSHMELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDV AAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHE
>3N7R_2 Receptor activity-modifying protein 1 (chains C, D) GSHMACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLG CFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS
| ID | Name | Formula | Copies |
|---|---|---|---|
| 3N6 | N-{(1S)-5-amino-1-[(4-pyridin-4-ylpiperazin-1-yl)carbonyl]pentyl}-3,5-dibromo-N… | C38 H47 Br2 N9 O5 | 1 |
| N7R | N-[(3R,6S)-6-(2,3-difluorophenyl)-2-oxo-1-(2,2,2-trifluoroethyl)azepan-3-yl]-4-… | C26 H27 F5 N6 O3 | 1 |
Crystal Structure of the Ectodomain Complex of the CGRP Receptor, a Class-B GPCR, Reveals the Site of Drug Antagonism. Ter Haar, E., Koth, C.M., Abdul-Manan, N. et al. Structure (2010) 18:1083-1093. DOI 10.1016/j.str.2010.05.014 · PubMed
Other PDB entries of the same protein (UniProt Q16602 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3N7R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.