3AQF: Human CRLR/RAMP2 extracellular complex

Crystal structure of the human CRLR/RAMP2 extracellular complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 2 Nov 2011.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,492
Mol. weight: 24.62 kDa
Released: 2 Nov 2011

Explore 3AQF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AQF contains 9 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	61-76	16
α-helix	77-82	6
α-helix	86-106	21
α-helix	114-126	13

Chain B: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	37-54	18
α-helix	56-58	3
β-strand	64-65	2	1
α-helix	66-67	2
β-strand	68-69	2	2
β-strand	74-75	2	2
β-strand	78-79	2	1
β-strand	82-87	6	3
α-helix	88-89	2
β-strand	95	1	4
β-strand	100-105	6	3
β-strand	111	1	3
β-strand	113	1	5
β-strand	120	1	5
β-strand	123	1	3
β-strand	128	1	4
α-helix	129-131	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor activity-modifying protein 2	A	protein	91	Homo sapiens	O60895 (AlphaFold model)
Calcitonin gene-related peptide type 1 receptor	B	protein	121	Homo sapiens	Q16602 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3AQF_1 Receptor activity-modifying protein 2 (chains A)
GSSGSSGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFD
LGFPNPLAERIIFETHQIHFANCSLVQPTFS

Sequence of entity 2 (B), FASTA

>3AQF_2 Calcitonin gene-related peptide type 1 receptor (chains B)
GSSGSSGELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCW
NDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKV
K

Primary citation

Structural basis for extracellular interactions between calcitonin receptor-like receptor and receptor activity-modifying protein 2 for adrenomedullin-specific binding. Kusano, S., Kukimoto-Niino, M., Hino, N. et al. Protein Sci (2012) 21:199-210. DOI 10.1002/pro.2003 · PubMed

Other PDB entries of the same protein (UniProt O60895 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RWF 1.76 Å, Crystal structure of the CLR:RAMP2 extracellular domain heterodimer with bound…
6V2E 1.83 Å, Crystal structure of the human CLR:RAMP2 extracellular domain heterodimer with bound…
3AQE 2.0 Å, Crystal structure of the extracellular domain of human RAMP2
2XVT 2.05 Å, Structure of the extracellular domain of human RAMP2
7TYX 2.55 Å, Human Amylin2 Receptor in complex with Gs and rat amylin peptide
9BQ3 2.8 Å, Human Amylin2 Receptor in Complex with Gs and Cagrilintide
6UUN 3.0 Å, CryoEM Structure of the active Adrenomedullin 1 receptor G protein complex with…
7TYY 3.0 Å, Human Amylin2 Receptor in complex with Gs and salmon calcitonin peptide
7TYH 3.3 Å, Human Amylin2 Receptor in complex with Gs and human calcitonin peptide

Browse structure collections

About this viewer

MolViewer shows 3AQF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.